Allele Report for C*14:21N

C*14:21N View HGVS Report
Pre-2010 Nomenclature: Local Names: C
IMGT/HLA Acc No: HLA05415 OMIM Entry: *142840
Assigned: 2010-06-30 Sequence Last Modified: 2010-07-16
Source Entries: FN908172  
Cells Sequence Derived From: D10000838  
Known Ethnic Origin Of Source: Oriental
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (142 aa)
MRVMAPRTLILLLSGALALTETWACSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEG
PEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMFGCDLGPDGRLLRGYDQSAX
Nucleotide Sequence Data (1101 bps)
ATGCGGGTCATGGCGCCCCGAACCCTCATCCTGCTGCTCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCTGCTCCCA
CTCCATGAGGTATTTCTCCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGTGGATGTTTGGCTGCGACCTGGGGCCCGACGGGCGCCTCC
TCCGCGGGTATGACCAGTCCGCCTAAGACGGCAAGGATTACATCGCCCTGAACGAGGATCTGCGCTCCTGGACCGCCGCG
GACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGAACACCCAAAGACACACGTGA
CCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGTGGGATGGGGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCCGGAGCCCC
TCACCCTGAGATGGGAGCCGTCTTCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTGGCTGTCCTGGCTGTC
CTAGCTGTCCTAGGAGCTGTGGTGGCTGTTGTGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTGCTCTCA
GGCTGCGTCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGCCTGA
Genomic Sequence Data (3099 bps)
TCGGGTCCTTCTTCCTGAATACTCATGACGCGTCCCCAATTCCCACTCCCATTGGGTGTCGGGTTCTAGAGAAGCCAATC
AGCGTCTCCGCAGTCCCGGTTCTAAAGTCCCCAGTCACCCACCCGGACTCAGATTCTCCCCAGACGCCGAGATGCGGGTC
ATGGCGCCCCGAACCCTCATCCTGCTGCTCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCTGTGAGTGCGGGGTTAG
GAGGGAAACGGCCTCTGCGGAGAGGAGCGAGGGGCCCGCCCGGCGAGGGCGCAGGACCCGGGGAGCCGCGCAGGGAGGAG
GGTCGGGCGGGTCTCAGCCACTCCTCGTCCCCAGGCTCCCACTCCATGAGGTATTTCTCCACATCCGTGTCCCGGCCCGG
CCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTC
CGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGC
CAGGCACAGACTGACCGAGTGAGCCTGCGGAACCTGCGCGGCTACTACAACCAGAGCGAGGCCGGTGAGTGACCCCGGCC
CGGGGCGCAGGTCACGACCCCTCCCCATCCCCCACGGACGGCCCGGGTCGCCCCGAGTCTCCCCGTCTGAGATCCACCCC
GAGGCTGCGGAACCCGCCCAGACCCTCGACCGGAGAGAGCCCCAGTCACCTTTACCCGGTTTCATTTTCAGTTTAGGCCA
AAATCCCCGCGGGTTGGTCGGGACTGGGGCGGGGCTCGGGGGACGGGGCTGACCACGGGGGCGGGGCCAGGGTCTCACAC
CCTCCAGTGGATGTTTGGCTGCGACCTGGGGCCCGACGGGCGCCTCCTCCGCGGGTATGACCAGTCCGCCTAAGACGGCA
AGGATTACATCGCCCTGAACGAGGATCTGCGCTCCTGGACCGCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGG
GAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAA
CGGGAAGGAGACGCTGCAGCGCGCGGGTACCAGGGGCAGTGGGGAGCCTTCCCCATCTCCCGTAGATCTCCCGGGATGGC
CTCCCACGAGGAGGGGAGGAAAATGGGATCAGCGCTAGAATATCGCCCTCCCTTGAATGGAGAATGGGATGAGTTTTCCT
GAGTTTCCTCTGAGGGCCCCCTCTGCTCTCTAGGACAATTAAGGGATGAAGTCCTTGAGGAAATGGAGGGGAAGACAGTC
CCTGGAATACTGATCAGGGGTCCCCTTTGACCACTTTGACCACTGCAGCAGCTGTGGTCAGGCTGCTGACCTTTCTCTCA
GGCCTTGTTCTCTGCCTCACGCTCAATGTGTTTGAAGGTTTGATTCCAGCTTTTCTGAGTCCTTCGGCCTCCACTCAGGT
CAGGACCAGAAGTCGCTGTTCCTCCCTCAGAGACTAGAACTTTCCAATGAATAGGAGATTATCCCAGGTGCCTGTGTCCA
GGCTGGCGTCTGGGTTCTGTGCCCCCTTCCCCACCCCAGGTGTCCTGTCCATTCTCAGGATGGTCACATGGGCGCTGTTG
GAGTGTCGCAAGAGAGATACAAAGTGTCTGAATTTTCTGACTCTTCCCGTCAGAACACCCAAAGACACACGTGACCCACC
ATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAG
TGGGATGGGGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAAGTGGGC
AGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCCGGAGCCCCTCACCC
TGAGATGGGGTAAGGAGGGGGATGAGGGGTGATGTGTCTTCTCAGGGAAAGCAGAAGTCCTGGAGCCCTTCAGCCGGGTC
AGGGCTGAGGCTTGGAGGTCAGGGCCCCTCACCTTCCCCTCCTTTCCCAGAGCCGTCTTCCCAGCCCACCATCCCCATCG
TGGGCATCGTTGCTGGCCTGGCTGTCCTGGCTGTCCTAGCTGTCCTAGGAGCTGTGGTGGCTGTTGTGATGTGTAGGAGG
AAGAGCTCAGGTAGGGAAGGGGTGAGGAGTGGGGTCTGGGTTTTCTTGTTCCACTGGGAGTTTCAAGCCCCAGGTAGAAG
TGTGCCCCACCTCGTTACTGGAAGCACCATCCACACATGGGCCATCCCAGCCTGGGACCCTGTGTGCCAGCACTTACTCT
GTTGTGAAGCACATGACAATGAAGGACAGATGTATCACCTTGATGATTATGGTGTTGGGGTCCTTGATTCCAGCATTCAT
GAGTCAGGGGAAGGTCCCTGCTAAGGACAGACCTTAGGAGGGCAGTTGCTTCAGGACCCACAGCTGCTTTCCCCGTGTTT
CCTGATCCTGCCCTGGGTCTGCAGTCATAGTTCTGGAAACTTCTCTTGGGTCCAAGACTAGGAGGTTCCCCTAAGATCGC
ATGGCCCTGCCTCCTCCCTGTCCCCTCACAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTGCTCTCAGGCTGC
GTGTAAGTGATGGCGGTGGGCGTGTGGAGGAGCTCACCCACCCCATAATTCCTCTTGTCCCACATCTCCTGTGGGCTCTG
ACCAGGTCTTTTTTTTTGTTCTACCCCAGCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGGTG
AGATTCTGGGGAGCTGAAGTGGTCGGGGGTGGGGCAGAGGGAAAAGGCCTGGGTAATGGGGATCCTTTGATTGGGACGTT
TCGAATGTGTGGTGAGCTGTTCAGAGTGTCATCACTTACCATGACTGACCTGAATTTGTTCATGACTATTGTGTTCTGTA
GCCTGAGACAGCTGCCTGTGTGGGACTGAGATGCAGGATTTCTTCACACCTCTCCTTTG

IMGT/HLA

Sponsors

Animated Sponsors Logo