Allele Report for C*12:43

C*12:43 View HGVS Report
Pre-2010 Nomenclature: Local Names: HistoGenetics HIS_NEW_C_617_01357
IMGT/HLA Acc No: HLA05214 OMIM Entry: *142840
Assigned: 2010-05-31 Sequence Last Modified: 2010-07-16
Source Entries: GQ240506 , GQ254383 , GQ859569 , GU289902 , HM044960 , HM125880 , HM159330  
Alignment of CDS Source Entries
C*01:02:01
C*12:43
Submission 1
Submission 2
Submission 3
Submission 4

Locus Reference
  Virtual entry for C*12:43 
  Individual submission(s) 

This feature is not currently available for some submissions of this allele.
Cells Sequence Derived From: HG00000671 , HG00000672 , HG00000673 , HG00001805 , HG00001806 , HG00002117 , HN-40533-4  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.5214 (Allele OID)
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 7 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGTEYWDRETQKYKRQAQADRVSLRNL
RGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLE
GTCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCA
GGAGGGGACGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGTGGATGTATGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
TGCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGTGGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors