Allele Report for C*08:94

C*08:94 View HGVS Report
Pre-2010 Nomenclature: Local Names: BY01130
IMGT/HLA Acc No: HLA10260 OMIM Entry: *142840
Assigned: 2013-09-30 Sequence Last Modified: 2015-01-19
Source Entries: KF551943 , LN600087  
Cells Sequence Derived From: BY01130 , DKMS-LSL-C-257  
Known Ethnic Origin Of Source: Mixed
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (366 aa)
MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEG
PEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAA
DKAAQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWGPSSQPTIPIVGIVAGLAVLAV
LAVLGAVMAVVMCRRKSSGGKGGSCSQAASSNSAQGSDESLIACKA
Nucleotide Sequence Data (1101 bps)
ATGCGGGTCATGGCGCCCCGAACCCTCATCCTGCTGCTCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCTGCTCCCA
CTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGGCGCCTCC
TCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAATGAGGACCTGCGCTCCTGGACCGCCGCG
GACAAGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGAAGACGCTGCAGCGCGCGGAACACCCAAAGACACACGTGA
CCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCCAGAGCCCC
TCACCCTGAGATGGGGGCCATCTTCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTGGCTGTCCTGGCTGTC
CTAGCTGTCCTAGGAGCTGTGATGGCTGTTGTGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTGCTCTCA
GGCTGCGTCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGCCTGA
Genomic Sequence Data (3349 bps)
GATCAGGACGAAGTCCCAGGTCCCGGGCGGGGCTCTCAGGGTCTCAGGCTCCAAGGGCCGTGTCTGCACTGGGGAGGCGC
CGCGTTGAGGATTCTCCACTCCCCTGAGTTTCACTTCTTCTTCCAACCTGCGTCGGGTCCTTCTTCCTGAATACTCATGA
CGCGTCCCCAATTCCCACTCCCATTGGGTGTCGGGTTCTAGAGAAGCCAATCAGCGTCTCCGCAGTCCCGGTTCTAAAGT
CCCCAGTCACCCACCCGGACTCGGATTCTCCCCAGACGCCGAGATGCGGGTCATGGCGCCCCGAACCCTCATCCTGCTGC
TCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCTGTGAGTGCGAGGTTGGGAGGGAAACGGCCTCTGCGGAGAGGAGC
GAGGGGCCCGCCCGGCGAGGGCGCAGGACCCGGGGAGCCGCGCAGGGAGGAGGGTCGGGCGGGTCTCAGCCCCTCCTCGC
CCCCAGGCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTG
GGCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGCGGGCGCCGTGGGT
GGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAGCCTGC
GGAACCTGCGCGGCTACTACAACCAGAGCGAGGCCGGTGAGTGACCCCGGCCCGGGGCGCAGGTCACGACCCCTCCCCAT
CCCCCACGGACGGCCCGGGTCGCCCCGAGTCTCCCGGTCTGAGATCCACCCCGAGGCTGCGGAACCCGCCCAGACCCTCG
ACCGGAGAGAGCCCCAGTCACCTTTACCCGGTTTCATTTTCAGTTTAGGCCAAAATCCCCGCGGGTTGGTCGGGGCTGGG
GCGGGGCTCGGGGGACGGGGCTGACCACGGGGGCGGGGCCAGGGTCTCACACCCTCCAGAGGATGTATGGCTGCGACCTG
GGGCCCGACGGGCGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAATGAGGACCT
GCGCTCCTGGACCGCCGCGGACAAGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGA
GAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGAAGACGCTGCAGCGCGCGGGT
ACCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTGTAGATCTCCCGGGATGGCCTCCCACGAGGAGGGGAGGAAAATGGGA
TCAGCGCTGGAATATCGCCCTCCCTTGAATGGAGAATGGGATGAGTTTTCCTGAGTTTCTTCTGAGGGCCCCCTCTGCTC
TCTAGGACAATTAAGGGATGAAGTCCTTGAGGAAATGGAGGGGAAGACAGTCCCTGGAATACTGATCAGGGGTCCCCTTT
GACCACTTTGACCACTGCAGCAGCTGTGGTCAGGCTGCTGACCTTTCTCTCAGGCCTTGTTCTCTGCCTCACGCTCAATG
TGTTTAAAGGTTTGATTCCAGCTTTTCTGAGTCCTTCGGCCTCCACTCAGGTCAGGACCAGAAGTCGCTGTTCCTCCCTC
AGAGACTAGAACTTTCCAATGAATAGGAGATTATCCCAGGTGCCTGTGTCCAGGCTGGCGTCTGGGTTCTGTGCCCCCTT
CCCCACCCCAGGTGTCCTGTCCATTCTCAGGATGGTCACATGGGCACTGTTGGAGTGTCGCAAGAGAGATACAAAGTGTC
TGAATTTTCTGACTCTTCCCGTCAGAACACCCAAAGACACACGTGACCCACCATCCCGTCTCTGACCATGAGGCCACCCT
GAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACA
CCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAG
CAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCCAGAGCCCCTCACCCTGAGATGGGGTAAGGAGGGGGATGAGGG
GTCATGTGTCTTCTCAGGGAAAGCAGAAGTCCTGGAGCCCTTCAGCCGGGTCAGGGCTGAGGCTTGGGGGTCAGGGCCCC
TCACCTTCCCCTCCTTTCCCAGGGCCATCTTCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTGGCTGTCCT
GGCTGTCCTAGCTGTCCTAGGAGCTGTGATGGCTGTTGTGATGTGTAGGAGGAAGAGCTCAGGTAGGGAAGGGGTGAGGA
GTGGGGTCTGGGTTTTCTTGTCCCACTGGGAGTTTCAAGCCCCAGGTAGAAGTGTGCCCCACCTCGTTACTGGAAGCACC
ATCCACACATGGGCCATCCCAGCCTGGGACCCTGTGTGCTAGCACTTACTCTGTTGTGAAGCACATGACAATGAAGGACA
GATGTATCACCTTGATGATTATGGTGTTGGGGTCCTTGATTCCAGCATTCATGAGTCAGGGGAAGGTCCCTGCTAAGGAC
AGACCTTAGGAGGGCAGTTGCTCCAGAACCCACAGCTGCTTTCCCCGTGTTTCCTGATCCTGCCCTGGGTCTGCAGTCAT
AGTTCTGGAAACTTCTCTTGGGTCCAAGACTAGGAGGTTCCCCTAAGATCGCATGGCCCTGCCTCCTCCCTGTCCCCTCA
CAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTGCTCTCAGGCTGCGTGTAAGTGATGGCGGTGGGCGTGTGGA
GGAGCTCACCCACCCCATAATTCCTCTTGTCCCACATCTCCTGCGGGCTCTGACCAGGTCTTTTTTTTTGTTCTACCCCA
GCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGGTGAGATTCTGGGGAGCTGAAGTGGTCGGGG
GTGGGGCAGAGGGAAAAGGCCTAGGTAATGGGGATCCTTTGATTGGGACGTTTCGAATGTGTGGTGAGCTGTTCAGAGTG
TCATCACTTACCATGACTGACCTGAATTTGTTCATGACTATTGTGTTCTGTAGCCTGAGACAGCTGCCTGTGTGGGACTG
AGATGCAGGATTTCTTCACACCTTTCCTTTGTGACTTCAAGAGCCTCTGGCATCTCTTTCTGCAAAGGCATCTGAATGTG
TCTGCGTTCCTGTTAGCATAATGTGAGGAGGTGGAGAGACAGCCCACCCCCGTGTCCACCGTGACCCCT

IMGT/HLA

Sponsors

Animated Sponsors Logo