Allele Report for C*08:36N

C*08:36N View HGVS Report
Pre-2010 Nomenclature: Local Names: C
IMGT/HLA Acc No: HLA05416 OMIM Entry: *142840
Assigned: 2010-06-30 Sequence Last Modified: 2012-10-17
Source Entries: FN908173  
Cells Sequence Derived From: D10000970  
Known Ethnic Origin Of Source: Oriental
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (98 aa)
MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEG
PDGVLGPGDTEVQAPGTD
Nucleotide Sequence Data (1105 bps)
ATGCGGGTCATGGCGCCCCGAACCCTCATCCTGCTGCTCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCTGCTCCCA
CTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCAGTTCGACAGCGACGCCGCGAGTCCAAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCGGACGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAGCCTGCGGAACCTGC
GCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGGCGC
CTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAATGAGGACCTGCGCTCCTGGACCGC
CGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTACGGCGGAGCAGCTGAGAGCCTACCTGGAGG
GCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGAAGACGCTGCAGCGCGCGGAACACCCAAAGACACAC
GTGACCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACT
GACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCC
AGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCCAGAG
CCCCTCACCCTGAGATGGGGGCCATCTTCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTGGCTGTCCTGGC
TGTCCTAGCTGTCCTAGGAGCTGTGATGGCTGTTGTGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTGCT
CTCAGGCTGCGTCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGCCTGA
Genomic Sequence Data (3097 bps)
AACCTGCGTCGGGTCCTTCTTCCTGAATACTCATGACGCGTCCCCAATTCCCACTCCCATTGGGTGTCGGGTTCTAGAGA
AGCCAATCAGCGTCTCCGCAGTCCCGGTTCTAAAGTCCCCAGTCACCCACCCGGACTCGGATTCTCCCCAGACGCCGAGA
TGCGGGTCATGGCGCCCCGAACCCTCATCCTGCTGCTCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCTGTGAGTGC
GAGGTTGGGAGGGAAACGGCCTCTGCGGAGAGGAGCGAGGGGCCCGCCCGGCGAGGGCGCAGGACCCGGGGAGCCGCGCA
GGGAGGAGGGTCGGGCGGGTCTCAGCCCCTCCTCGCCCCCAGGCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCC
CGGCCCGGCCGCGGAGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACGACACGCAGTTCGTGCAGTTCGACAGCGACGC
CGCGAGTCCAAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGGCCGGACGGAGTATTGGGACCGGGAGACACAG
AAGTACAAGCGCCAGGCACAGACTGACCGAGTGAGCCTGCGGAACCTGCGCGGCTACTACAACCAGAGCGAGGCCGGTGA
GTGACCCCGGCCCGGGGCGCAGGTCCCGACCCCTCCCCATCCCCCACGGACGGCCCGGGTCGCCCCGAGTCTCCCGGTCT
GAGATCCACCCCGAGGCTGCGGAACCCGCCCAGACCCTCGACCGGAGAGAGCCCCAGTCACCTTTACCCGGTTTCATTTT
CAGTTTAGGCCAAAATCCCCGCGGGTTGGTCGGGGCTGGGGCGGGGCTCGGGGGACGGGGCTGACCACGGGGGCGGGGCC
AGGGTCTCACACCCTCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGGCGCCTCCTCCGCGGGTATAACCAGTTCG
CCTACGACGGCAAGGATTACATCGCCCTGAATGAGGACCTGCGCTCCTGGACCGCCGCGGACACGGCGGCTCAGATCACC
CAGCGCAAGTGGGAGGCGGCCCGTACGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAG
ATACCTGGAGAACGGGAAGAAGACGCTGCAGCGCGCGGGTACCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTGTAGATC
TCCCGGGATGGCCTCCCACGAGGAGGGGAGGAAAATGGGATCAGCGCTGGAATATCGCCCTCCCTTGAATGGAGAATGGG
ATGAGTTTTCCTGAGTTTCCTCTGAGGGCCCCCTCTGCTCTCTAGGACAATTAAGGGATGAAGTCCTTGAGGAAATGGAG
GGGAAGACAGTCCCTGGAATACTGATCAGGGGTCCCCTTTGACCACTTTGACCACTGCAGCAGCTGTGGTCAGGCTGCTG
ACCTTTCTCTCAGGCCTTGTTCTCTGCCTCACGCTCAATGTGTTTAAAGGTTTGATTCCAGCTTTTCTGAGTCCTTCGGC
CTCCACTCAGGTCAGGACCAGAAGTCGCTGTTCCTCCCTCAGAGACTAGAACTTTCCAATGAATAGGAGATTATCCCAGG
TGCCTGTGTCCAGGCTGGCGTCTGGGTTCTGTGCCCCCTTCCCCACCCCAGGTGTCCTGTCCATTCTCAGGATGGTCACA
TGGGCACTGTTGGAGTGTCGCAAGAGAGATACAAAGTGTCTGAATTTTCTGACTCTTCCCGTCAGAACACCCAAAGACAC
ACGTGACCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACA
CTGACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTT
CCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCCAG
AGCCCCTCACCCTGAGATGGGGTAAGGAGGGGGATGAGGGGTCATGTGTCTTCTCAGGGAAAGCAGAAGTCCTGGAGCCC
TTCAGCCGGGTCAGGGCTGAGGCTTGGGGGTCAGGGCCCCTCACCTTCCCCTCCTTTCCCAGGGCCATCTTCCCAGCCCA
CCATCCCCATCGTGGGCATCGTTGCTGGCCTGGCTGTCCTGGCTGTCCTAGCTGTCCTAGGAGCTGTGATGGCTGTTGTG
ATGTGTAGGAGGAAGAGCTCAGGTAGGGAAGGGGTGAGGAGTGGGGTCTGGGTTTTCTTGTCCCACTGGGAGTTTCAAGC
CCCAGGTAGAAGTGTGCCCCACCTCGTTACTGGAAGCACCATCCACACATGGGCCATCCCAGCCTGGGACCCTGTGTGCT
AGCACTTACTCTGTTGTGAAGCACATGACAATGAAGGACAGATGTATCACCTTGATGATTATGGTGTTGGGGTCCTTGAT
TCCAGCATTCATGAGTCAGGGGAAGGTCCCTGCTAAGGACAGACCTTAGGAGGGCAGTTGCTCCAGAACCCACAGCTGCT
TTCCCCGTGTTTCCTGATCCTGCCCTGGGTCTGCAGTCATAGTTCTGGAAACTTCTCTTGGGTCCAAGACTAGGAGGTTC
CCCTAAGATCGCATGGCCCTGCCTCCTCCCTGTCCCCTCACAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTG
CTCTCAGGCTGCGTGTAAGTGATGGCGGTGGGCGTGTGGAGGAGCTCACCCACCCCATAATTCCTCTTGTCCCACATCTC
CTGCGGGCTCTGACCAGGTCTTTTTTTTTGTTCTACCCCAGCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCG
CTTGTAAAGGTGAGATTCTGGGGAGCTGAAGTGGTCGGGGGTGGGGCAGAGGGAAAAGGCCTAGGTAATGGGGATCCTTT
GATTGGGACGTTTCGAATGTGTGGTGAGCTGTTCAGAGTGTCATCACTTACCATGACTGACCTGAATTTGTTCATGACTA
TTGTGTTCTGTAGCCTGAGACAGCTGCCTGTGTGGGACTGAGATGCAGGATTTCTTC

IMGT/HLA

Sponsors

Animated Sponsors Logo