Allele Report for C*07:104N

C*07:104N View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_C_429_00445, HIS_NEW_C_595_01271
IMGT/HLA Acc No: HLA04996 OMIM Entry: *142840
Assigned: 2010-04-30 Sequence Last Modified: 2010-07-16
Source Entries: FJ875628 , GQ345097 , HM768867 , HQ011370 , HQ590539 , JF292479 , JF292480 , JF292481 , JN119560 , JN119561 , JN119562 , JQ007660 , JQ824431 , JQ824432  
Cells Sequence Derived From: HG00002088 , HG00002089 , HG00002090 , HG00002534 , HG00002535 , HG00002536 , HG00003143 , HG00003144 , HG00003145 , HG00005077 , HG00005078 , HG00005079 , HN-09454-9 , HN-56003-7  
Known Ethnic Origin Of Source: Mixed
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 14 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (117 aa)
SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRNL
RGYYNQSEDGSHTLQRMYGCDLGPDGRLLRGYDQSAX
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCGACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAACTACAAGCGCCAGGCACAGGCTGACCGAGTGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATGACCAGTCCGCCTAGGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCCGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTTGGAGGCGGCCCGTGCGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo