Allele Report for C*07:101

C*07:101 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_C_378_00360, HIS_NEW_C_552_01033
IMGT/HLA Acc No: HLA04982 OMIM Entry: *142840
Assigned: 2010-04-30 Sequence Last Modified: 2010-07-16
Source Entries: FJ765990 , GQ180450 , GU590974 , GU811799 , HM004252 , HM467564 , HM467565 , HM467566 , HM594805 , HQ644392 , JN123949 , JN242453  
Alignment of CDS Source Entries
C*01:02:01
C*07:101
Submission 1
Submission 2
Submission 3
Submission 4

Locus Reference
  Virtual entry for C*07:101 
  Individual submission(s) 

This feature is not currently available for some submissions of this allele.
Cells Sequence Derived From: HG00001014 , HG00001667 , HG00001668 , HG00001669 , HG00001670 , HG00001671 , HG00001672 , HG00002070 , HG00002508 , HG00003236 , HN-17796-4 , HN-96196-9  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.4982 (Allele OID)
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 12 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNL
RGYYNQSEDGSHTFQRMYGCDLGPDGRLLRGYDQFAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQDRAYLE
GTCVEWLRRYLENGKKTLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCGACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCAGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCCCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGACGGGTCTCACACCTTCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATGACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCCGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTTGGAGGCGGCCCGTGCGGCGGAGCAGGACAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGAAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors