Allele Report for C*07:02:24

C*07:02:24 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_C_765_01777
IMGT/HLA Acc No: HLA06381 OMIM Entry: *142840
Assigned: 2011-01-31 Sequence Last Modified: 2011-04-08
Source Entries: HM125871 , HQ215007 , HQ644412  
Cells Sequence Derived From: HG00001547 , HG00001548 , HG10011728  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNL
RGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLE
GTCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCGACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGAGGATGTCTGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCCGCGGACACCGCGGCCCAGATCACCCAGCGCAAGTTGGAGGCGGCCCGTGCGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo