Allele Report for C*07:02:01:05

C*07:02:01:05 View HGVS Report
Pre-2010 Nomenclature: Local Names: HLA-C
IMGT/HLA Acc No: HLA07778 OMIM Entry: *142840
Assigned: 2012-02-29 Sequence Last Modified: 2012-10-17
Source Entries: AB679918  
Cells Sequence Derived From:  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 0 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (366 aa)
MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEG
PEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAA
DTAAQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVV
LAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDESLITCKA
Nucleotide Sequence Data (1101 bps)
ATGCGGGTCATGGCGCCCCGAGCCCTCCTCCTGCTGCTCTCGGGAGGCCTGGCCCTGACCGAGACCTGGGCCTGCTCCCA
CTCCATGAGGTATTTCGACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGAGGATGTCTGGCTGCGACCTGGGGCCCGACGGGCGCCTCC
TCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCCGCG
GACACCGCGGCTCAGATCACCCAGCGCAAGTTGGAGGCGGCCCGTGCGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCAGAACCCCCAAAGACACACGTGA
CCCACCACCCCCTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGACAAGAGCAGAGATACACGTGCCATATGCAGCACGAGGGGCTGCAAGAGCCCC
TCACCCTGAGCTGGGAGCCATCTTCCCAGCCCACCATCCCCATCATGGGCATCGTTGCTGGCCTGGCTGTCCTGGTTGTC
CTAGCTGTCCTTGGAGCTGTGGTCACCGCTATGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTGCTCTCA
GGCTGCGTGCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCACTTGTAAAGCCTGA
Genomic Sequence Data (3354 bps)
GATCAGGACGAAGTCCCAGGTCCCGGGCGGGGCTCTCAGGGTCTCAGGCTCCAAGGGCCGTGTCTGCATTGGGGAGGCGC
CGCGTTGGGGATTCTCCACTCCCCTGAGTTTCACTTCTCCCAACCTGCGTCGGGTCCTTCTTCCTGAATACTCATGACGC
GTCCCCAATTCCCACTCCCATTGGGTGTCGGGTTCTAGAGAAGCCAATCAGCGTCTCCGCAGTCCCGGTTCTAAAGTCCC
CAGTCACCCACCCGGACTCACATTCTCCCCAGAGGCCGAGATGCGGGTCATGGCGCCCCGAGCCCTCCTCCTGCTGCTCT
CGGGAGGCCTGGCCCTGACCGAGACCTGGGCCTGTGAGTGCGGGGTTGGGAGGGAAGCGGCCTCTGCGGAGAGGAGCGAG
GGGCCCTCCCGGCGAGGGCGCAGGACCCGGGGAGCCGCGCAGGGAGGTGGGTCGGGCGGGTCTCAGCCCCTCCTCGCCCC
CAGGCTCCCACTCCATGAGGTATTTCGACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGC
TACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGA
GCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAGCCTGCGGA
ACCTGCGCGGCTACTACAACCAGAGCGAGGACGGTGAGTGACCCCGGCCCGGGGCGCAGGTCACGACCCCTCCCCATCCC
CCACGGACGGCCCGGGTCGCCTAGAGTCTCCCCGTCTGAGATCCACCCCAAGGTGGATCTGCGGAACCCGCCCAGACCCT
CGACCGGAGAGAGCCCCAGTCGCCTTTACCCGGTTTCATTTTCGGTTTAGGCCAAAATCCCCGCGGGTTGGTCGGGGCGG
GGCGGGGCTCGGGGGACTGGGCTGACCGCGGGGGCGGGGCCAGGGTCTCACACCCTCCAGAGGATGTCTGGCTGCGACCT
GGGGCCCGACGGGCGCCTCCTCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACC
TGCGCTCCTGGACCGCCGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTTGGAGGCGGCCCGTGCGGCGGAGCAGCTG
AGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCAGG
TACCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTATAGATCTCCCGGGATGGCCTCCCACGAGGAGGGGAGGAAAATGGG
ATCAGCACTGGAATATCGCCCTCCCTTGAATGGAGAATGGCATGAGTTTTCCTGAGTTTCCTCTGAGGGCCCCCTCTGCT
CTCTAGGACAATTAAGGGATGAAGTCTCTGAGGAAATGGAGGGGAAGACAGTCCCTGGAATACTGATCAGGGGTCTCCTT
TGACCACTTTGACCACTGCAGCAGCTGTGGTCAGGCTGCTGACCTTTCTCTCAGGCCTTGTTCTCTGCCTCACACTCAAT
GTGTCTGAAGGTTTGATTCCAGCTTTTCTGAGTCCTGCAGCCTCCACTCAGGTCAGGACCAGAAGTCGCTGTTCCTCCCT
CAGAGACTAGAACTTTCCAATGAATAGGAGATTATCCCAGGTGCCTGTGTCCAGGCTGGCGTCTGGGTTCTGTGCCGCCT
TCCCCACCCCAGGTGTCCTGTCCATTCTCAGGATGGTCACATGGGCGCTGCTGGAGTGTCCCAAGAGAGATGCAAAGTGT
CTGAATTTTCTGACTCTTCCCGTCAGAACCCCCAAAGACACACGTGACCCACCACCCCCTCTCTGACCATGAGGCCACCC
TGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGGGAGGACCAGACCCAGGAC
ACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGACAAGA
GCAGAGATACACGTGCCATATGCAGCACGAGGGGCTGCAAGAGCCCCTCACCCTGAGCTGGGGTAAGGAGGGGAATGGGG
GGTCACATCTCTTATCAGAGAAAGCAGAAGTCCTTCTGGAGCCCTTCAGCCGGGTCAGGGCTGAGGCTTGGGGGTCAGGG
CCCCTCACCTTCTCCTCCTTTCCCAGAGCCATCTTCCCAGCCCACCATCCCCATCATGGGCATCGTTGCTGGCCTGGCTG
TCCTGGTTGTCCTAGCTGTCCTTGGAGCTGTGGTCACCGCTATGATGTGTAGGAGGAAGAGCTCAGGTAGGGAAGGGGTG
AAGAGCGGGGTCTGGGTTTTCTTGTCCCACTGGGAGTTTCAAGCCCCAGGTAGAAGTGTGCCCCGCCTTGTTACTGGAAG
CACCATCCACACATGGGCCATCCCAGCCTGGGACCCTGTGTGCCAGCACTTACTCTTTTGTGAAGCACATGTGACAATGA
AGGACGGATGTATCACCTTGATGATTATGGTGTTGGGGTCCTGATTCCAGCATTCATGAGTCAGGGGAAGGTCCCTGCTA
AGGACAGACCTTAGGAGGGCAGTTGGTCCAGAACCCACAACTGCTTTCCCCATGTTTCCTGATCCTGCCCTGGGTCTGCA
GTCGTAGTTCTGGAAACTTCTCTTGGGTCCAAGACTAGGAGGTTCCCCTAAGATCACATGGCCCTGCCTCCTCCCAGTCC
CCTCATAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTGCTCTCAGGCTGCGTGTAAGTGATGGCGGCGGGCGT
GTGGAGGAGCTCACCTACTCCATAATTCCTCTTGTCCCACATCTCCTGCGGGCTCTGACCAGGTCTTTTTTTTTGTTCTA
CCCCAGGCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCACTTGTAAAGGTGAGATTCTGGGGAGCTGAAGTGGT
CGGGGGTGGGGCAGAGGGAAAAGGCCTGGGTAATGGGGATTCTTTGATTGGGACGTTTCGAGTGTGTGGTGGGCCGTTCA
GAGTGTCATCGCTTACCATGACTGACCTGAATTTGTTCATGACTATTGTGTTCTGTAGCCTGAGACAGCTGCCTGTGTGG
GACTGAGATGCAGGATTTCTTCACACCTCTCCTTTGTGACTTCAAGAGCCTCTGGCATCTCTTTCTGCAAAGGCACCTGA
ATGTGTCTGCGTTCCTGTTAGCATAATGTGAGGAGGTGGAGAGACAGCCCACCCCCGTGTCCACCGTGACCCCT

IMGT/HLA

Sponsors

Animated Sponsors Logo