Allele Report for C*06:46N

C*06:46N View HGVS Report
Pre-2010 Nomenclature: Local Names: C
IMGT/HLA Acc No: HLA05526 OMIM Entry: *142840
Assigned: 2010-07-31 Sequence Last Modified: 2010-10-15
Source Entries: FN908170  
Cells Sequence Derived From: D10000220  
Known Ethnic Origin Of Source: Oriental
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (248 aa)
MRVMAPRTLILLLSGALALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEG
PEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAA
DTAAQITQRKWEAAREAEQWRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLT
WQRDGEDX
Nucleotide Sequence Data (1101 bps)
ATGCGGGTCATGGCGCCCCGAACCCTCATCCTGCTGCTCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCTGCTCCCA
CTCCATGAGGTATTTCGACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCCCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAACCTGCGGAAACTGCGCGG
CTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGTGGATGTATGGCTGCGACCTGGGGCCCGACGGGCGCCTCC
TCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCCGCG
GACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGTGGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGAACACCCAAAGACACACGTGA
CCCACCATCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGCGAGGACTAAACTCAGGACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCCAGAGCCCC
TCACCCTGAGATGGGAGCCATCTTCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTGGCTGTCCTGGCTGTC
CTAGCTGTCCTAGGAGCTGTGATGGCTGTTGTGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTGCTCTCA
GGCTGCGTCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGCCTGA
Genomic Sequence Data (2987 bps)
AAGTCCCCAGTCACCCACCCGGACTCGGATTCTCCCCAGACGCCGAGATGCGGGTCATGGCGCCCCGAACCCTCATCCTG
CTGCTCTCGGGAGCCCTGGCCCTGACCGAGACCTGGGCCTGTGAGTGCGGGGTTGGGAGGGAAACGGCCTCTGCGGAGAG
GAGCGAGGGGCCCGCCCGGCGAGGGCGCAGGACCCGGGGAGCCGCGCAGGGAGGTGGGTCGGGCGGGTCTCAGCCCCTCC
TCGCCCCCAGGCTCCCACTCCATGAGGTATTTCGACACCGCCGTGTCCCGGCCCGGCCGCGGAGAGCCCCGCTTCATCTC
AGTGGGCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCCCGGGCGCCGT
GGGTGGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAAC
CTGCGGAAACTGCGCGGCTACTACAACCAGAGCGAGGACGGTGAGTGACCCCGGCCCGGGGCGCAGGTCACGACCCCTCC
CCATCCCCCACGGACGGCCCGGGTCGCCCCGAGTCTCCCGGTCTGAGATCCACCCCGAGGCTGCGGAACCCGCCCAGACC
CTCGACCGGAGAGAGCCCCAGTCACCTTTACCCGGTTTCATTTTCAGTTTAGGCCAAAATCCCCGCGGGTTGGTCGGGGC
TGGGGCGGGGCTCGGGGGACGGGGCTGACCACGGGGGCGGGGCCAGGGTCTCACACCCTCCAGTGGATGTATGGCTGCGA
CCTGGGGCCCGACGGGCGCCTCCTCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGG
ACCTGCGCTCCTGGACCGCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAG
TGGAGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGC
GGGTACCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTGTAGATCTCCCGGGATGGCCTCCCACGAGGAGGGGAGGAAAAT
GGGATCAGCGCTAGAATATCGCCCTCCCTTGAATGGAGAATGGGATGAGTTTTCCTGAGTTTCCTCTGAGGGCCCCCTCT
GCTCTCTAGGACAATTAAGGGATGAAGTCCTTGAGGAAATGGAGGGGAAGACAGTCCCTGGAATACTGATCAGGGGTCCC
CTTTGACCACTTTGACCACTGCAGCAGCTGTGGTCAGGCTGCTGACCTTTCTCTCAGGCCTTGTTCTCTGCCTCACGCTC
AATGTGTTTAAAGGTTTGATTCCAGCTTTTCTGAGTCCTTCGGCCTCCACTCAGGTCAGGACCAGAAGTCGCTGTTCCTC
CCTCAGAGACTAGAACTTTCCAATGAATAGGAGATTATCCCAGGTGCCTGTGTCCAGGCTGGCGTCTGGGTTCTGTGCCC
CCTTCCCCACCCCAGGTGTCCTGTCCATTCTCAGGATGGTCACATGGGTGCTGTTGGAGTGTCGCAAGAGAGATACAAAG
TGTCTGAATTTTCTGACTCTTCCCGTCAGAACACCCAAAGACACACGTGACCCACCATCCCGTCTCTGACCATGAGGCCA
CCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGCGAGGACTAAACTCAG
GACACCGAGCTTGTGGAGACCAGGCCAGCAGGAGATGGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGA
AGAGCAGAGATACACGTGCCATGTGCAGCACGAGGGGCTGCCAGAGCCCCTCACCCTGAGATGGGGTAAGGAGGGGGATG
AGGGGTCATGTGTCTTCTCAGGGAAAGCAGAAGTCCTGGAGCCCTTCAGCCGGGTCAGGGCTGAGGCTTGGGGGTCAGGG
CCCCTCACCTTCCCCTCCTTTCCCAGAGCCATCTTCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTGGCTG
TCCTGGCTGTCCTAGCTGTCCTAGGAGCTGTGATGGCTGTTGTGATGTGTAGGAGGAAGAGCTCAGGTAGGGAAGGGGTG
AGGAGTGGGGTCTGGGTTTTCTTGTCCCACTGGGAGTTTCAAGCCCCAGGTAGAAGTGTGCCCCACCTCGTTACTGGAAG
CACCATCCACACATGGGCCATCCCAGCCTGGGACCCTGTGTGCTAGCACTTACTCTGTTGTGAAGCACATGACAATGAAG
GACAGATGTATCACCTTGATGATTATGGTGTTGGGGTCCTTGATTCCAGCATTCATGAGTCAGGGGAAGGTCCCTGCTAA
GGACAGACCTTAGGAGGGCAGTTGCTCCAGAACCCACAGCTGCTTTCCCCGTGTTTCCTGATCCTGCCCTGGGTCTGCAG
TCATAGTTCTGGAAACTTCTCTTGGGTCCAAGACTAGGAGGTTCCCCTAAGATCGCATGGCCCTGCCTCCTCCCTGTCCC
CTCACAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTGCTCTCAGGCTGCGTGTAAGTGATGGCGGTGGGCGTG
TGGAGGAGCTCACCCACCCCATAATTCCTCTTGTCCCACATCTCCTGCGGGCTCTGACCAGGTCTTTTTTTTTGTTCTAC
CCCAGCCAGCAACAGTGCCCAGGGCTCTGATGAGTCTCTCATCGCTTGTAAAGGTGAGATTCTGGGGAGCTGAAGTGGTC
TGGGGTGGGGCAGAGGGAAAAGGCCTAGGTAATGGGGATCCTTTGATTGGGACGTTTCGAATGTGTGGTGAGCTGTTCAG
AGTGTCATCACTTACCATGACTGACCTGAATTTGTTCATGACTATTGTGTTCTGTAGCCTGAGACAGCTGCCTGTGTGGG
ACTGAGATGCAGGATTTCTTCACACCT

IMGT/HLA

Sponsors

Animated Sponsors Logo