Allele Report for C*06:02:09

C*06:02:09 View HGVS Report
Pre-2010 Nomenclature: Local Names: HistoGenetics HIS_NEW_C_585_01217
IMGT/HLA Acc No: HLA05602 OMIM Entry: *142840
Assigned: 2010-08-31 Sequence Last Modified: 2010-10-15
Source Entries: GQ254385 , HQ337730  
Cells Sequence Derived From: HG10011917 , HN-78260-5  
Known Ethnic Origin Of Source: Unknown
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRKL
RGYYNQSEDGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLE
GTCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCGACACCGCCGTGTCCCGGCCGGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCCCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGGCTGACCGAGTGAACCTGCGGAAAC
TGCGCGGCTACTACAACCAGAGCGAGGACGGGTCTCACACCCTCCAGTGGATGTATGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGTGGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo