Allele Report for C*03:88

C*03:88 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_C_531_00843, HIS_NEW_C_550_00970, HIS_NEW_C_571_01175, HIS_NEW_C_600_01290
IMGT/HLA Acc No: HLA05162 OMIM Entry: *142840
Assigned: 2010-05-31 Sequence Last Modified: 2010-07-16
Source Entries: GQ161052 , GQ180387 , GQ180464 , GQ240562 , GQ401222 , HM562323 , HM562325 , HM594803 , JN124378 , JN124379 , JN124416 , JN124549 , JN124550 , JN629061 , JQ824489  
Cells Sequence Derived From: HG00001576 , HG00001577 , HG00001578 , HG00003196 , HG00003197 , HG00003198 , HG00003199 , HG00003200 , HG00003201 , HG00005117 , HN-000600 , HN-002530 , HN-45917-7 , HN-8929468 , HN-P001-09  
Known Ethnic Origin Of Source: Oriental
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 15 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNL
RGYYNQSEARSHIIQRMYGCDVGPDGHLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLE
GLCVEWLRRYLKNGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCTGTGTCCCGGCCCGGCCGCGGGGAGCCCCACTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCAGGTCTCACATCATCCAGAGGATGTATGGCTGCGACGTGGGGCCCGACGGG
CACCTCCTCCGCGGGTATGACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGATCTGCGCTCCTGGAC
CGCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCCTGTGCGTGGAGTGGCTCCGCAGATACCTGAAGAATGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo