Allele Report for C*01:36

C*01:36 View HGVS Report
Pre-2010 Nomenclature: Cw*0136 Local Names: HistoGenetics HIS_NEW_C_422_00414
IMGT/HLA Acc No: HLA04756 OMIM Entry: *142840
Assigned: 2010-02-22 Sequence Last Modified: 2010-04-01
Source Entries: FJ875582  
Alignment of CDS Source Entries
C*01:02:01:01
C*01:36
Submission 1

Locus Reference
  Virtual entry for C*01:36 
  Individual submission(s) 
Cells Sequence Derived From: HN-79074-7  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.4756 (Allele OID)
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMKYFFTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNL
RGYYNQSEAGSHTLQRMFGCDLGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLE
GTCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAAGTATTTCTTCACATCCGTGTCCCGGCCTGGCCGCGGAGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGTCCGAGAGGGGAGCCGCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGAAGTACAAGCGCCAGGCACAGACTGACCGAGTGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTTTGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGTATGACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCCGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

Further Information

For more information about the database, queries (including website) or to subscribe to the IPD mailing lists please contact IPD Support.

Please see our licence for our terms of use.