Allele Report for B*15:153

B*15:153 View HGVS Report
Pre-2010 Nomenclature: B*9553 Local Names: HLA-B*1518GI1208
IMGT/HLA Acc No: HLA03606 OMIM Entry: *142830
Assigned: 2009-01-31 Sequence Last Modified: 2009-04-17
Source Entries: FJ235006 , FJ235036 , FJ235067 , FJ346298 , FJ346317 , FJ502329 , FJ502331 , FJ765568 , FJ765769 , FJ765846 , FJ765946 , FJ765947 , FJ765974 , FJ853791 , FJ866154 , FJ866158 , FJ866162 , FJ866164 , FJ866171 , FJ866174 , FJ875565 , FJ898493 , FM957458 , GQ149278 , GQ245745 , GQ254341 , GQ859547  
Cells Sequence Derived From: 1443/08 , HN-01906-4 , HN-04085-5 , HN-1153829 , HN-17386-8 , HN-21535-8 , HN-33766-3 , HN-35520-8 , HN-50145-3 , HN-50489-5 , HN-51811-9 , HN-57199-8 , HN-57761-5 , HN-61040-4 , HN-63152-6 , HN-70918-2 , HN-71150-9 , HN-73160-1 , HN-75152-5 , HN-76459-8 , HN-77532-2 , HN-81313-3 , HN-86738-9 , HN-88641-3 , HN-94111-9 , HN-96223-1 , HN-96967-5  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Wienzek-Lischka S et al. Tissue Antigens 76:156-158 2010. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 27 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTYRESLRNL
RGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTGAQITQRKWEAAREAEQLRAYLE
GLCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGAACACACAGATCTGCAAGACCAACACACAGACTTACCGAGAGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTACGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGCATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCGGCGGACACGGGGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCCTGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo