Allele Report for B*82:01

B*82:01 View HGVS Report
Pre-2010 Nomenclature: B*8201 Local Names: B*5602var, B*8201, B*82new-64B
IMGT/HLA Acc No: HLA00399 OMIM Entry: *142830
Assigned: 1995-09-07 Sequence Last Modified: 2008-04-08
Source Entries: AF017321 , AJ278748 , U29241 , U36492 , U38800 , U43337  
Cells Sequence Derived From: 64B , MAMA , MAME , MAPA , RB22 , VWAR  
Known Ethnic Origin Of Source: Black
Publications
Hurley CK et al. Tissue Antigens 47:179-87 1996. (View abstract)
Ellexson M et al. Tissue Antigens 47:438-41 1996. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 6 Laboratories: 4
HLA Dictionary Data
Expert Assigned Type: B82 WHO Assigned Type: B82
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 1 B'8201' [28%] B22 [9%]
NMDP (2008) 146 blank [68%] B45 [4%] B70 [4%] B'82' [3%] B65 [3%]
13 IHWC (2002) 4 B'82'
Neural Network Assigned Type: B56
Comments: B22x45, reactive with some B45 and B22 sera; ihw13: pattern almost included in B55 
Protein Sequence (206 aa)
MRVTAPRTLLLLLWGALALTETWAGSHSMRYFYTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEG
PEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQRMFGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAA
DTAAQITQRKWEAARVAEQDRAYLEDLCVESLRRYLENGKETLQRA
Nucleotide Sequence Data (619 bps)
ATGCGGGTCACGGCACCCCGAACCCTCCTCCTGCTGCTCTGGGGGGCCCTGGCCCTGACCGAGACCTGGGCTGGCTCCCA
CTCCATGAGGTATTTCTACACCGCTATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGG
CCGGAGTATTGGGACCGGAACACACAGATCTACAAGGCCCAGGCACAGACTGACCGAGAGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTTTGGCTGCGACCTGGGGCCCGACGGGCGCCTCC
TCCGCGGGCATAACCAGTTAGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGACCGCGGCG
GACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGGACAGAGCCTACCTGGAGGACCT
GTGCGTGGAGTCGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo