Allele Report for B*55:16

B*55:16 View HGVS Report
Pre-2010 Nomenclature: B*5516 Local Names: CHD635
IMGT/HLA Acc No: HLA01788 OMIM Entry: *142830
Assigned: 2003-07-31 Sequence Last Modified: 2003-10-15
Source Entries: AJ966345 , AY339847  
Cells Sequence Derived From: CHD635  
Known Ethnic Origin Of Source: Oriental
Publications
Chen Q et al. Tissue Antigens 68:339-43 2006. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 1 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: B55 WHO Assigned Type: B22
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) - -
Neural Network Assigned Type: B55
Comments:
Protein Sequence (206 aa)
MRVTAPRTLLLLLWGALALTETWAGSHSMRYFHTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREEPRAPWIEQEG
PEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTWQTMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAA
DTAAQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (619 bps)
ATGCGGGTCACGGCACCCCGAACCCTCCTCCTGCTGCTCTGGGGGGCCCTGGCCCTGACCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCCACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGG
CCGGAGTATTGGGACCGGAACACACAGATCTACAAGGCCCAGGCACAGACTGACCGAGAGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGGTCTCACACTTGGCAGACGATGTATGGCTGCGACCTGGGGCCGGACGGGCGCCTCC
TCCGCGGGCATAACCAGTTAGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGACCGCGGCG
GACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo