Allele Report for B*53:22

B*53:22 View HGVS Report
Pre-2010 Nomenclature: B*5322 Local Names: BY00603
IMGT/HLA Acc No: HLA04713 OMIM Entry: *142830
Assigned: 2010-01-31 Sequence Last Modified: 2010-04-01
Source Entries: GU299428 , JN383934  
Cells Sequence Derived From: BY00603 , BY00873  
Known Ethnic Origin Of Source: Black, Hispanic
CWD v2.0 Status: Not defined
Publications
Lazaro AM et al. Tissue Antigens 78:195-202 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIA
LRYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLE
GLCVESLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGGACGGAGCCCCGGGCGCCATGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGAACACACAGATCTTCAAGACCAACACACAGACTTACCGAGAGAACCTGCGGATCG
CGCTCCGCTACTACAACCAGAGCGAGGCCGGGTCTCACATCATCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGCATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGGACAGAGCCTACCTGG
AGGGCCTGTGCGTGGAGTCGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo