Allele Report for B*51:09:01

B*51:09:01
Pre-2010 Nomenclature: B*510901 Local Names: B*51IM, B-5101V, B*51N, B*5101Variant, B*5109
IMGT/HLA Acc No: HLA00354 OMIM Entry: *142830
Assigned: 1996-06-29 Sequence Last Modified: 1998-12-16
Source Entries: AF002272 , AF017320 , AF028599 , AF028600 , AF054001 , AF054002 , AF165848 , AF165849 , AH005069 , AH005673 , AH006297 , AH006383 , AH009660 , JN673551 , U58319 , U58320 , U76400 , U76401  
Cells Sequence Derived From: CS00118 , GN00178 , GN00204 , GN00205 , IMM721 , NM4B437 , NMDP-000409232-2 , RN285B  
Known Ethnic Origin Of Source: Caucasoid
Publications
Hurley CK et al. Tissue Antigens 52:84-7 1998. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 8 Laboratories: 6
HLA Dictionary Data
Expert Assigned Type: B51 WHO Assigned Type: B51(5)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 43 B51 [86%]
13 IHWC (2002) - -
Neural Network Assigned Type: Training - B5 B51
Comments:
Protein Sequence (181 aa)
SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIA
LRYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLE
GLCVEWLRRHLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATTGCAGTGGGCTAC
GTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGGACGGAGCCCCGGGCGCCATGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGAACACACAGATCTTCAAGACCAACACACAGACTTACCGAGAGAACCTGCGGATCG
CGCTCCGCTACTACAACCAGAGCGAGGCCGGGTCTCACACTTGGCAGACGATGTATGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGCATAACCAGTACGCCTACGACGGCAAAGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCCTGTGCGTGGAGTGGCTCCGCAGACACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo