Allele Report for B*49:05

B*49:05 View HGVS Report
Pre-2010 Nomenclature: B*4905 Local Names: 147554
IMGT/HLA Acc No: HLA02342 OMIM Entry: *142830
Assigned: 2005-09-23 Sequence Last Modified: 2006-01-12
Source Entries: AM076839  
Cells Sequence Derived From: 147554  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Andreini E et al. Tissue Antigens 67:174-6 2006. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: B49 WHO Assigned Type: B49(21)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) - -
Neural Network Assigned Type: B49
Comments:
Protein Sequence (273 aa)
SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRIA
LRYYNQSEAGSHTWQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLE
GLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTF
QKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Nucleotide Sequence Data (822 bps)
GCTCCCACTCCATGAGGTATTTCCACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCACCGTGGGCTAC
GTGGACGACACGCTGTTCGTGAGGTTCGACAGCGACGCCACGAGTCCGAGGAAGGAGCCGCGGGCGCCATGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGAACCTGCGGATCG
CGCTCCGCTACTACAACCAGAGCGAGGCCGGGTCTCACACTTGGCAGAGGATGTATGGCTGCGACCTGGGGCCGGACGGG
CGCCTCCTCCGCGGGTATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCCTGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGACCCCCCAAAGACA
CATGTGACCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCAC
ACTGACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGACCAGCAGGAGATAGAACCT
TCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCG
AAGCCCCTCACCCTGAGATGGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo