Allele Report for B*48:03:02

B*48:03:02 View HGVS Report
Pre-2010 Nomenclature: B*480302 Local Names: BY00137
IMGT/HLA Acc No: HLA02727 OMIM Entry: *142830
Assigned: 2006-11-30 Sequence Last Modified: 2007-01-12
Source Entries: EF078989 , FJ594559 , GQ410094 , GU066741  
Cells Sequence Derived From: BY00137 , BY00509 , BY00529 , HN-1833602  
Known Ethnic Origin Of Source: Hispanic
Publications
Lazaro AM et al. Tissue Antigens 71:471-4 2008. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 4 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: B48 WHO Assigned Type: B48c
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 1 B48 [97%]
NMDP (2008) 32 B48 [66%] B60 [13%]
13 IHWC (2002) 1 B48
Neural Network Assigned Type: B48
Comments:
Protein Sequence (181 aa)
SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNL
RGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLE
GECVEWLRRYLENGKDKLERA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTATGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGCATAACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCCGCGGACACGGCGGCTCAGATCTCCCAGCGCAAGTTGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCGAGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGACAAGCTGGAGCGCGCTG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo