Allele Report for B*44:02:27

B*44:02:27 View HGVS Report
Pre-2010 Nomenclature: Local Names: HLA-B*44:XX
IMGT/HLA Acc No: HLA08601 OMIM Entry: *142830
Assigned: 2012-09-30 Sequence Last Modified: 2013-01-18
Source Entries: JX564251  
Cells Sequence Derived From: 557-46  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
van Soest M et al. Tissue Antigens 81:230-231 2013. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (362 aa)
MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEG
PEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAA
DTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAV
VVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSLTA
Nucleotide Sequence Data (1089 bps)
ATGCGGGTCACGGCGCCCCGAACCCTCCTCCTGCTGCTCTGGGGGGCAGTGGCCCTGACCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCACCGTGGGCTACGTGGACG
ACACGCTGTTCGTGAGGTTCGACAGCGACGCCACGAGTCCGAGGAAGGAGCCGCGGGCGCCATGGATAGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGAACCTGCGCACCGCGCTCCG
CTACTACAACCAGAGCGAGGCCGGGTCTCACATCATCCAGAGGATGTACGGCTGCGACGTGGGGCCGGACGGGCGCCTCC
TCCGCGGGTATGACCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGACCGCGGCG
GACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGGACAGAGCCTACCTGGAGGGCCT
GTGCGTGGAGTCGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGACCCCCCAAAGACACATGTGA
CCCACCACCCCATCTCTGACCATGAGGTCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGACCAGCAGGAGATAGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCGAAGCCCC
TCACCCTGAGATGGGAGCCGTCTTCCCAGTCCACTGTCCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGTT
GTGGTCATCGGAGCTGTGGTCGCTGCTGTGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTACTCTCAGGC
TGCGTGCAGCGACAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGA
Genomic Sequence Data (2872 bps)
CAACCTATGTCGGGTCCTTCTTCCAGGATACTCGTGACGCGTCCCCATTTCCCACTCCCATTGGGTGTCGGGTGTCTAGA
GAAGCCAATCAGTGTCGCCGGGGTCCCAGTTCTAAAGTCCCCACGCACCCACCCGGACTCAGAATCTCCTCAGACGCCGA
GATGCGGGTCACGGCGCCCCGAACCCTCCTCCTGCTGCTCTGGGGGGCAGTGGCCCTGACCGAGACCTGGGCCGGTGAGT
GCGGGGTCGGGAGGGAAATGGCCTCTGTGGGGAGGAGAGAGGGGACCGCAGGCGGGGGCGCAGGACCCGGGGAGCCGCGC
CGGGAGGAGGGTCGGGCGGGTCTCAGCCCCTCCTCGCCCCCAGGCTCCCACTCCATGAGGTATTTCTACACCGCCATGTC
CCGGCCCGGCCGCGGGGAGCCCCGCTTCATCACCGTGGGCTACGTGGACGACACGCTGTTCGTGAGGTTCGACAGCGACG
CCACGAGTCCGAGGAAGGAGCCGCGGGCGCCATGGATAGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATC
TCCAAGACCAACACACAGACTTACCGAGAGAACCTGCGCACCGCGCTCCGCTACTACAACCAGAGCGAGGCCGGTGAGTG
ACCCCGGCCCGGGGCGCAGGTCACGACTCCCCATCCCCCACGTACGGCCCGGGTCGCCCCGAGTCTCCGGGTCCGAGATC
CGCCCCCGAGGCCGCGGGACCCGCCCAGACCCTCGACCGGCGAGAGCCCCAGGCGCGTTTACCCGGTTTCATTTTCAGTT
GAGGCCAAAATCCCCGCGGGTTGGTCGGGGCGGGGCGGGGCTCGGGGGACGGGGCTGACCGCGGGGCCGGGGCCAGGGTC
TCACATCATCCAGAGGATGTACGGCTGCGACGTGGGGCCGGACGGGCGCCTCCTCCGCGGGTATGACCAGGACGCCTACG
ACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGACCGCGGCGGACACCGCGGCTCAGATCACCCAGCGC
AAGTGGGAGGCGGCCCGTGTGGCGGAGCAGGACAGAGCCTACCTGGAGGGCCTGTGCGTGGAGTCGCTCCGCAGATACCT
GGAGAACGGGAAGGAGACGCTGCAGCGCGCGGGTACCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTATAGGTCGCCGGG
GATGGCCTCCCACGAGAAGAGGAGGAAAATGGGATCAGCGCTAGAATGTCGCCCTCCCTTGAATGGAGAATGGCATGAGT
TTTCCTGAGTTTCCTCTGAGGGCCCCCTCTTCTCTCTAGGACAATTAAGGGATGACGTCTCTGAGGAAATGGAGGGGAAG
ACAGTCCCTAGAATACTGATCAGGGGTCCCCTTTGACCCCTGCAGCAGCCTTGGGAACCGTGACTTTTCCTCTCAGGCCT
TGTTCTCTGCCTCACACTCAGTGTGTTTGGGGCTCTGATTCCAGCACTTCTGAGTCACTTTACCTCCACTCAGATCAGGA
GCAGAAGTCCCTGTTCCCCGCTCAGAGACTCGAACTTTCCAATGAATAGGAGATTATCCCAGGTGCCTGCGTCCAGGCTG
GTGTCTGGGTTCTGTGCCCCTTCCCCACCCCAGGTGTCCCGTCCATTCTCAGGCTGGTCACATGGGTGGTCCTAGGGTGT
CCCATGAGAGATGCAAAGCGCCTGAATTTTCTGACTCTTCCCATCAGACCCCCCAAAGACACATGTGACCCACCACCCCA
TCTCTGACCATGAGGTCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGAT
GGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGACCAGCAGGAGATAGAACCTTCCAGAAGTGGGCAGCTGT
GGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCGAAGCCCCTCACCCTGAGAT
GGGGTAAGGAGGGGGATGAGGGGTCATATCTCTTCTCAGGGAAAGCAGGAGCCCTTCAGCAGGGTCAGGGCCCCTCATCT
TCCCTTCCTTTCCCAGAGCCGTCTTCCCAGTCCACTGTCCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGT
TGTGGTCATCGGAGCTGTGGTCGCTGCTGTGATGTGTAGGAGGAAGAGCTCAGGTAGGGAAGGGGTGAGGGGTGGGGTCT
GGGTTTTCTTGTCCCACTGGGGGTTTCAAGCCCCAGGTAGAAGTGTTCCCTGCCTCATTACTGGGAAGCAGCATCCACAC
AGGGGCTAACGCAGCCTGGGACCCTGTGTGCCAGCACTTACTCTTTTGTGCAGCACATGTGACAATGAAGGACGGATGTA
TCACCTTGGTGGTTGTGGTGTTGGGGTCCTGATTCCAGCATTCATGAGTCAGGGGAAGGTCCCTGCTAAGGACAGACCTT
AGGAGGGCAGTTGGTCCAGGACCCACACTTGCTTTCCTCGTGTTTCCTGATCCTGCCTTGGGTCTGTAGTCATACTTCTG
GAAATTCCTTTTGGGTCCAAGACGAGGAGGTTCCTCTAAGATCTCATGGCCCTGCTTCCTCCCAGTCCCCTCACAGGGCA
TTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTACTCTCAGGCTGCGTGTAAGTGATGGGGGCGGGAGTGTGGAGGAGCTC
ACCCACCCCATAATTCCTCCTGTCCCACGTCTCCTGCGGGCTCTGACCAGGTCCTGTTTTTGTTCTACTCCAGGCAGCGA
CAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGAAAAGGTGAGATTCTTGGGGTCTAGAGTGGGTGGGG

IMGT/HLA

Sponsors

Animated Sponsors Logo