Allele Report for B*44:02:17

B*44:02:17 View HGVS Report
Pre-2010 Nomenclature: Local Names: SRANN
IMGT/HLA Acc No: HLA06304 OMIM Entry: *142830
Assigned: 2010-12-22 Sequence Last Modified: 2011-01-14
Source Entries: HQ693697  
Cells Sequence Derived From: SRANN  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (362 aa)
MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEG
PEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAA
DTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAV
VVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSLTA
Nucleotide Sequence Data (1089 bps)
ATGCGGGTCACGGCGCCCCGAACCCTCCTCCTGCTGCTCTGGGGGGCAGTGGCCCTGACCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCACCGTGGGCTACGTGGACG
ACACGCTGTTCGTGAGGTTCGACAGCGACGCCACGAGTCCGAGGAAGGAGCCGCGGGCGCCATGGATAGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGAACCTGCGCACCGCGCTCCG
CTACTACAACCAGAGCGAGGCCGGGTCTCACATCATCCAGAGGATGTACGGCTGCGACGTGGGGCCGGACGGGCGCCTCC
TCCGCGGGTATGACCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGACCGCGGCG
GACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGGACAGAGCCTACCTGGAGGGCCT
GTGCGTGGAGTCGCTCCGCAGATACCTGGAGAACGGGAAGGAGACCCTGCAGCGCGCGGACCCCCCAAAGACACATGTGA
CCCACCACCCCATCTCTGACCATGAGGTCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGACCAGCAGGAGATAGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCGAAGCCCC
TCACCCTGAGATGGGAGCCGTCTTCCCAGTCCACCGTCCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGTT
GTGGTCATCGGAGCTGTGGTCGCTGCTGTGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTACTCTCAGGC
TGCGTGCAGCGACAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGA
Genomic Sequence Data (3323 bps)
GATCAGGACGAAGTCCCAGGTCCCGGACGGGGCTCTCAGGGTCTCAGGCTCCGAGGGCCGCGTCTGCAATGGGGAGGCGC
AGCGTTGGGGATTCCCCACTCCCACGAGTTTCACTTCTTCTCCCAACCTATGTCGGGTCCTTCTTCCAGGATACTCGTGA
CGCGTCCCCATTTCCCACTCCCATTGGGTGTCGGGTGTCTAGAGAAGCCAATCAGTGTCGCCGGGGTCCCAGTTCTAAAG
TCCCCACGCACCCACCCGGACTCAGAATCTCCTCAGACGCCGAGATGCGGGTCACGGCGCCCCGAACCCTCCTCCTGCTG
CTCTGGGGGGCAGTGGCCCTGACCGAGACCTGGGCCGGTGAGTGCGGGGTCGGGAGGGAAATGGCCTCTGTGGGGAGGAG
AGAGGGGACCGCAGGCGGGGGCGCAGGACCCGGGGAGCCGCGCCGGGAGGAGGGTCGGGCGGGTCTCAGCCCCTCCTCGC
CCCCAGGCTCCCACTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCACCGTG
GGCTACGTGGACGACACGCTGTTCGTGAGGTTCGACAGCGACGCCACGAGTCCGAGGAAGGAGCCGCGGGCGCCATGGAT
AGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGAACCTGC
GCACCGCGCTCCGCTACTACAACCAGAGCGAGGCCGGTGAGTGACCCCGGCCCGGGGCGCAGGTCACGACTCCCCATCCC
CCACGTACGGCCCGGGTCGCCCCGAGTCTCCGGGTCCGAGATCCGCCCCCGAGGCCGCGGGACCCGCCCAGACCCTCGAC
CGGCGAGAGCCCCAGGCGCGTTTACCCGGTTTCATTTTCAGTTGAGGCCAAAATCCCCGCGGGTTGGTCGGGGCGGGGCG
GGGCTCGGGGGACGGGGCTGACCGCGGGGCCGGGGCCAGGGTCTCACATCATCCAGAGGATGTACGGCTGCGACGTGGGG
CCGGACGGGCGCCTCCTCCGCGGGTATGACCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAG
CTCCTGGACCGCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGGACAGAG
CCTACCTGGAGGGCCTGTGCGTGGAGTCGCTCCGCAGATACCTGGAGAACGGGAAGGAGACCCTGCAGCGCGCGGGTACC
AGGGGCAGTGGGGAGCCTTCCCCATCTCCTATAGGTCGCCGGGGATGGCCTCCCACGAGAAGAGGAGGAAAATGGGATCA
GCGCTAGAATGTCGCCCTCCCTTGAATGGAGAATGGCATGAGTTTTCCTGAGTTTCCTCTGAGGGCCCCCTCTTCTCTCT
AGGACAATTAAGGGATGACGTCTCTGAGGAAATGGAGGGGAAGACAGTCCCTAGAATACTGATCAGGGGTCCCCTTTGAC
CCCTGCAGCAGCCTTGGGAACCGTGACTTTTCCTCTCAGGCCTTGTTCTCTGCCTCACACTCAGTGTGTTTGGGGCTCTG
ATTCCAGCACTTCTGAGTCACTTTACCTCCACTCAGATCAGGAGCAGAAGTCCCTGTTCCCCGCTCAGAGACTCGAACTT
TCCAATGAATAGGAGATTATCCCAGGTGCCTGCGTCCAGGCTGGTGTCTGGGTTCTGTGCCCCTTCCCCACCCCAGGTGT
CCTGTCCATTCTCAGGCTGGTCACATGGGTGGTCCTAGGGTGTCCCATGAGAGATGCAAAGCGCCTGAATTTTCTGACTC
TTCCCATCAGACCCCCCAAAGACACATGTGACCCACCACCCCATCTCTGACCATGAGGTCACCCTGAGGTGCTGGGCCCT
GGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGA
CCAGACCAGCAGGAGATAGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGC
CATGTACAGCATGAGGGGCTGCCGAAGCCCCTCACCCTGAGATGGGGTAAGGAGGGGGATGAGGGGTCATATCTCTTCTC
AGGGAAAGCAGGAGCCCTTCAGCAGGGTCAGGGCCCCTCATCTTCCCTTCCTTTCCCAGAGCCGTCTTCCCAGTCCACCG
TCCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGTTGTGGTCATCGGAGCTGTGGTCGCTGCTGTGATGTGT
AGGAGGAAGAGCTCAGGTAGGGAAGGGGTGAGGGGTGGGGTCTGGGTTTTCTTGTCCCACTGGGGGTTTCAAGCCCCAGG
TAGAAGTGTTCCCTGCCTCATTACTGGGAAGCAGCATCCACACAGGGGCTAACGCAGCCTGGGACCCTGTGTGCCAGCAC
TTACTCTTTTGTGCAGCACATGTGACAATGAAGGACGGATGTATCACCTTGGTGGTTGTGGTGTTGGGGTCCTGATTCCA
GCATTCATGAGTCAGGGGAAGGTCCCTGCTAAGGACAGACCTTAGGAGGGCAGTTGGTCCAGGACCCACACTTGCTTTCC
TCGTGTTTCCTGATCCTGCCTTGGGTCTGTAGTCATACTTCTGGAAATTCCTTTTGGGTCCAAGACGAGGAGGTTCCTCT
AAGATCTCATGGCCCTGCTTCCTCCCAGTCCCCTCACAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTACTCT
CAGGCTGCGTGTAAGTGATGGGGGCGGGAGTGTGGAGGAGCTCACCCACCCCATAATTCCTCCTGTCCCACGTCTCCTGC
GGGCTCTGACCAGGTCCTGTTTTTGTTCTACTCCAGGCAGCGACAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGA
AAAGGTGAGATTCTTGGGGTCTAGAGTGGGTGGGGTGGCAGGTCTGGGGGTGGGTGGGGCAGTGGGGAAAGGCCTGGGTA
ATGGAGATTCTTTGATTGGGATGTTTCGCGTGTGTGGTGGGCTGTTTAGAGTGTCATCACTTACCATGACTAACCAGAAT
TTGTTCATGACTGTTGTTTTCTGTAGCCTGAGACAGCTGTCTTGTGAGGGACTGAGATGCAGGATTTCTTCACGCCTCCC
CTTTGTGACTTCAAGAGCCTCTGGCATCTCTTTCTGCAAAGGCACCTGAATGTGTCTGCGTCCCTGTTAGCATAATGTGA
GGAGGTGGAGAGACAGCCCACCCCCGTGTCCACCGTGACCCCT

IMGT/HLA

Sponsors

Animated Sponsors Logo