Allele Report for B*44:03:03

B*44:03:03 View HGVS Report
Pre-2010 Nomenclature: B*440303 Local Names: 93455
IMGT/HLA Acc No: HLA02825 OMIM Entry: *142830
Assigned: 2007-02-28 Sequence Last Modified: 2007-04-12
Source Entries: EF215530  
Cells Sequence Derived From: 93455  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: B44 WHO Assigned Type: B44(12)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 30 B44 [97-100%]
NMDP (2008) 2854 B44 [94%]
13 IHWC (2002) 65 B44
Neural Network Assigned Type: Training - B12 B44
Comments:
Protein Sequence (296 aa)
GAVALTETWAGSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTN
TQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTEL
VETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVG
Nucleotide Sequence Data (890 bps)
GGGGGCAGTGGCCCTGACCGAGACCTGGGCCGGCTCCCACTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCC
GCGGGGAGCCCCGCTTCATCACCGTGGGCTACGTGGACGACACGCTGTTCGTGAGGTTCGACAGCGACGCCACGAGTCCG
AGGAAGGAGCCGCGGGCGCCATGGATAGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAA
CACACAGACTTACCGAGAGAACCTGCGCACCGCGCTCCGCTACTACAACCAGAGCGAGGCCGGGTCTCACATCATCCAGA
GGATGTACGGCTGCGACGTGGGGCCGGACGGGCGCCTCCTCCGCGGGTATGACCAGGACGCCTACGACGGCAAGGATTAC
ATCGCCCTGAACGAGGACCTGAGCTCCTGGACCGCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGC
CCGTGTGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCCTGTGCGTGGAGTCGCTCCGCAGATACCTGGAGAACGGGAAGG
AGACGCTGCAGCGCGCGGACCCCCCAAAGACACATGTGACCCACCACCCCATCTCTGACCATGAGGTCACCCTGAGGTGC
TGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCT
TGTGGAGACCAGACCAGCAGGAGATAGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCCTCTGGAGAAGAGCAGAGAT
ACACATGCCATGTACAGCATGAGGGGCTGCCGAAGCCCCTCACCCTGAGATGGGAGCCGTCTTCCCAGTCCACCGTCCCC
ATCGTGGGCA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo