Allele Report for B*44:02:06

B*44:02:06 View HGVS Report
Pre-2010 Nomenclature: B*440206 Local Names: HistoGenetics HIS_NEW_B_201_00058
IMGT/HLA Acc No: HLA03953 OMIM Entry: *142830
Assigned: 2009-06-30 Sequence Last Modified: 2009-10-19
Source Entries: FJ235015 , GQ491085 , GU354109 , HM125822 , HM159322 , HM187684 , HM362850 , HM362851 , HM362860 , HM362873 , HM362877 , HM467503 , HM768848 , HM768849 , HQ154208 , HQ154211 , HQ154213 , HQ337678  
Cells Sequence Derived From: HG00001368 , HG00001369 , HG00001370 , HG00001371 , HG00001372 , HG00001373 , HG00001374 , HG00001375 , HG00001376 , HG00001377 , HG00001378 , HG00001379 , HG00001380 , HG10011697 , HG10011698 , HG10011699 , HN-20948-6 , HN-N261934  
Known Ethnic Origin Of Source: Caucasoid
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 18 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTA
LRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLE
GLCVESLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCACCGTGGGCTAC
GTGGACGACACGCTGTTCGTGAGGTTCGACAGCGACGCCACGAGTCCGAGGAAGGAGCCGCGGGCGCCATGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGAACCTGCGCACCG
CGCTCCGCTACTACAACCAGAGCGAGGCCGGGTCTCACATCATCCAGAGGATGTACGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTTCGCGGGTATGACCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGGACAGAGCCTACCTGG
AGGGCCTGTGCGTGGAGTCGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo