Allele Report for B*44:02:01:01

B*44:02:01:01 View HGVS Report
Pre-2010 Nomenclature: B*44020101 Local Names: B*4402101, B44.1, B44.2
IMGT/HLA Acc No: HLA00318 OMIM Entry: *142830
Assigned: 1989-08-01 Sequence Last Modified: 1998-12-16
Source Entries: AJ309936 , BX247310 , HG794398 , HM595428 , M15470 , M24038  
Cells Sequence Derived From: 7550800776 , BAU , FMB , RG-BR , SSTO , WILO05690  
Known Ethnic Origin Of Source: Caucasoid, Oriental
Publications
Parham P et al. Proc Natl Acad Sci U S A 85:4005-9 1988. (View abstract)
Kottmann AH et al. Immunogenetics 23:396-400 1986. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 6 Laboratories: 6
HLA Dictionary Data
Expert Assigned Type: B44 WHO Assigned Type: B44(12)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - B44 [99-100%]
NMDP (2008) 6959 B44 [98%]
13 IHWC (2002) 55 B44
Neural Network Assigned Type: Training - B12 B44
Comments:
Protein Sequence (362 aa)
MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEG
PEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAA
DTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAV
VVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSLTA
Nucleotide Sequence Data (1089 bps)
ATGCGGGTCACGGCGCCCCGAACCCTCCTCCTGCTGCTCTGGGGGGCAGTGGCCCTGACCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCACCGTGGGCTACGTGGACG
ACACGCTGTTCGTGAGGTTCGACAGCGACGCCACGAGTCCGAGGAAGGAGCCGCGGGCGCCATGGATAGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGAACCTGCGCACCGCGCTCCG
CTACTACAACCAGAGCGAGGCCGGGTCTCACATCATCCAGAGGATGTACGGCTGCGACGTGGGGCCGGACGGGCGCCTCC
TCCGCGGGTATGACCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGACCGCGGCG
GACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGGACAGAGCCTACCTGGAGGGCCT
GTGCGTGGAGTCGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGACCCCCCAAAGACACATGTGA
CCCACCACCCCATCTCTGACCATGAGGTCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGACCAGCAGGAGATAGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCGAAGCCCC
TCACCCTGAGATGGGAGCCGTCTTCCCAGTCCACCGTCCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGTT
GTGGTCATCGGAGCTGTGGTCGCTGCTGTGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTACTCTCAGGC
TGCGTGCAGCGACAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGA
Genomic Sequence Data (3323 bps)
GATCAGGACGAAGTCCCAGGTCCCGGACGGGGCTCTCAGGGTCTCAGGCTCCGAGGGCCGCGTCTGCAATGGGGAGGCGC
AGCGTTGGGGATTCCCCACTCCCACGAGTTTCACTTCTTCTCCCAACCTATGTCGGGTCCTTCTTCCAGGATACTCGTGA
CGCGTCCCCATTTCCCACTCCCATTGGGTGTCGGGTGTCTAGAGAAGCCAATCAGTGTCGCCGGGGTCCCAGTTCTAAAG
TCCCCACGCACCCACCCGGACTCAGAATCTCCTCAGACGCCGAGATGCGGGTCACGGCGCCCCGAACCCTCCTCCTGCTG
CTCTGGGGGGCAGTGGCCCTGACCGAGACCTGGGCCGGTGAGTGCGGGGTCGGGAGGGAAATGGCCTCTGTGGGGAGGAG
AGAGGGGACCGCAGGCGGGGGCGCAGGACCCGGGGAGCCGCGCCGGGAGGAGGGTCGGGCGGGTCTCAGCCCCTCCTCGC
CCCCAGGCTCCCACTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCACCGTG
GGCTACGTGGACGACACGCTGTTCGTGAGGTTCGACAGCGACGCCACGAGTCCGAGGAAGGAGCCGCGGGCGCCATGGAT
AGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGAACCTGC
GCACCGCGCTCCGCTACTACAACCAGAGCGAGGCCGGTGAGTGACCCCGGCCCGGGGCGCAGGTCACGACTCCCCATCCC
CCACGTACGGCCCGGGTCGCCCCGAGTCTCCGGGTCCGAGATCCGCCCCCGAGGCCGCGGGACCCGCCCAGACCCTCGAC
CGGCGAGAGCCCCAGGCGCGTTTACCCGGTTTCATTTTCAGTTGAGGCCAAAATCCCCGCGGGTTGGTCGGGGCGGGGCG
GGGCTCGGGGGACGGGGCTGACCGCGGGGCCGGGGCCAGGGTCTCACATCATCCAGAGGATGTACGGCTGCGACGTGGGG
CCGGACGGGCGCCTCCTCCGCGGGTATGACCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAG
CTCCTGGACCGCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGGACAGAG
CCTACCTGGAGGGCCTGTGCGTGGAGTCGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGGTACC
AGGGGCAGTGGGGAGCCTTCCCCATCTCCTATAGGTCGCCGGGGATGGCCTCCCACGAGAAGAGGAGGAAAATGGGATCA
GCGCTAGAATGTCGCCCTCCCTTGAATGGAGAATGGCATGAGTTTTCCTGAGTTTCCTCTGAGGGCCCCCTCTTCTCTCT
AGGACAATTAAGGGATGACGTCTCTGAGGAAATGGAGGGGAAGACAGTCCCTAGAATACTGATCAGGGGTCCCCTTTGAC
CCCTGCAGCAGCCTTGGGAACCGTGACTTTTCCTCTCAGGCCTTGTTCTCTGCCTCACACTCAGTGTGTTTGGGGCTCTG
ATTCCAGCACTTCTGAGTCACTTTACCTCCACTCAGATCAGGAGCAGAAGTCCCTGTTCCCCGCTCAGAGACTCGAACTT
TCCAATGAATAGGAGATTATCCCAGGTGCCTGCGTCCAGGCTGGTGTCTGGGTTCTGTGCCCCTTCCCCACCCCAGGTGT
CCTGTCCATTCTCAGGCTGGTCACATGGGTGGTCCTAGGGTGTCCCATGAGAGATGCAAAGCGCCTGAATTTTCTGACTC
TTCCCATCAGACCCCCCAAAGACACATGTGACCCACCACCCCATCTCTGACCATGAGGTCACCCTGAGGTGCTGGGCCCT
GGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGA
CCAGACCAGCAGGAGATAGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGC
CATGTACAGCATGAGGGGCTGCCGAAGCCCCTCACCCTGAGATGGGGTAAGGAGGGGGATGAGGGGTCATATCTCTTCTC
AGGGAAAGCAGGAGCCCTTCAGCAGGGTCAGGGCCCCTCATCTTCCCTTCCTTTCCCAGAGCCGTCTTCCCAGTCCACCG
TCCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGTTGTGGTCATCGGAGCTGTGGTCGCTGCTGTGATGTGT
AGGAGGAAGAGCTCAGGTAGGGAAGGGGTGAGGGGTGGGGTCTGGGTTTTCTTGTCCCACTGGGGGTTTCAAGCCCCAGG
TAGAAGTGTTCCCTGCCTCATTACTGGGAAGCAGCATCCACACAGGGGCTAACGCAGCCTGGGACCCTGTGTGCCAGCAC
TTACTCTTTTGTGCAGCACATGTGACAATGAAGGACGGATGTATCACCTTGGTGGTTGTGGTGTTGGGGTCCTGATTCCA
GCATTCATGAGTCAGGGGAAGGTCCCTGCTAAGGACAGACCTTAGGAGGGCAGTTGGTCCAGGACCCACACTTGCTTTCC
TCGTGTTTCCTGATCCTGCCTTGGGTCTGTAGTCATACTTCTGGAAATTCCTTTTGGGTCCAAGACGAGGAGGTTCCTCT
AAGATCTCATGGCCCTGCTTCCTCCCAGTCCCCTCACAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTACTCT
CAGGCTGCGTGTAAGTGATGGGGGCGGGAGTGTGGAGGAGCTCACCCACCCCATAATTCCTCCTGTCCCACGTCTCCTGC
GGGCTCTGACCAGGTCCTGTTTTTGTTCTACTCCAGGCAGCGACAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGA
AAAGGTGAGATTCTTGGGGTCTAGAGTGGGTGGGGTGGCAGGTCTGGGGGTGGGTGGGGCAGTGGGGAAAGGCCTGGGTA
ATGGAGATTCTTTGATTGGGATGTTTCGCGTGTGTGGTGGGCTGTTTAGAGTGTCATCACTTACCATGACTAACCAGAAT
TTGTTCATGACTGTTGTTTTCTGTAGCCTGAGACAGCTGTCTTGTGAGGGACTGAGATGCAGGATTTCTTCACGCCTCCC
CTTTGTGACTTCAAGAGCCTCTGGCATCTCTTTCTGCAAAGGCACCTGAATGTGTCTGCGTCCCTGTTAGCATAATGTGA
GGAGGTGGAGAGACAGCCCACCCCCGTGTCCACCGTGACCCCT

IMGT/HLA

Sponsors

Animated Sponsors Logo