Allele Report for B*40:86

B*40:86 View HGVS Report
Pre-2010 Nomenclature: B*4086 Local Names: HLA-B*400601
IMGT/HLA Acc No: HLA03245 OMIM Entry: *142830
Assigned: 2008-02-27 Sequence Last Modified: 2013-10-11
Source Entries: AB829608 , EU434746  
Cells Sequence Derived From: JMDP36K0195 , SDBC-1  
Known Ethnic Origin Of Source: Oriental
Publications
Zhu C et al. Tissue Antigens 72:181-2 2008. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (273 aa)
SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNL
RGYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLE
GECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTF
QKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Nucleotide Sequence Data (822 bps)
GCTCCCACTCCATGAGGTATTTCCACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCACCGTGGGCTAC
GTGGACGACACGCTGTTCGTGAGGTTCGACAGCGACGCCACGAGTCCGAGGAAGGAGCCGCGGGCGCCATGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACTTGGCAGACGATGTATGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGCATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCGAGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGACCCCCCAAAGACA
CACGTGACCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCAC
ACTGACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACACTGAGCTTGTGGAGACCAGACCAGCAGGAGATAGAACCT
TCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCG
AAGCCCCTCACCCTGAGATGGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo