Allele Report for B*40:124:02

B*40:124:02 View HGVS Report
Pre-2010 Nomenclature: Local Names: BJ086850
IMGT/HLA Acc No: HLA05391 OMIM Entry: *142830
Assigned: 2010-06-30 Sequence Last Modified: 2010-07-16
Source Entries: HM347430  
Cells Sequence Derived From: BJ086850  
Known Ethnic Origin Of Source: Oriental
Publications
Li D et al. Tissue Antigens 81:464-465 2013. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNL
RGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLE
GECVEWLRRYLENGKDKLERA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCCACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCACCGTGGGCTAC
GTGGACGACACGCTGTTCGTGAGGTTCGACAGCGACGCCACGAGTCCGAGGAAGGAGCCGCGGGCGCCATGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTACGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGTACCACCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCCGCGGACACGGCGGCTCAGATCTCCCAGCGCAAGTTGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCGAGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGACAAGCTGGAGCGCGCTG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo