Allele Report for B*40:02:05

B*40:02:05 View HGVS Report
Pre-2010 Nomenclature: B*400205 Local Names: 105479
IMGT/HLA Acc No: HLA03757 OMIM Entry: *142830
Assigned: 2009-04-30 Sequence Last Modified: 2009-07-17
Source Entries: FJ807734  
Alignment of CDS Source Entries
B*07:02:01
B*40:02:05
Submission 1

Locus Reference
  Virtual entry for B*40:02:05 
  Individual submission(s) 
Cells Sequence Derived From: 105479  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.3757 (Allele OID)
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (296 aa)
GAVALTETWAGSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTN
TQTYRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTEL
VETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVG
Nucleotide Sequence Data (890 bps)
GGGGGCAGTGGCCCTGACCGAGACCTGGGCTGGCTCCCACTCCATGAGGTATTTCCACACCTCCGTGTCCCGGCCCGGCC
GCGGGGAGCCCCGCTTCATCACCGTGGGCTACGTGGACGACACGCTGTTCGTGAGGTTCGACAGCGACGCCACAAGTCCG
AGGAAGGAGCCGCGGGCGCCATGGATAGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAA
CACACAGACTTACCGAGAGAGCCTGCGGAACCTGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGA
GCATGTACGGCTGCGACGTGGGGCCGGACGGGCGCCTCCTCCGCGGGCATAACCAGTACGCCTACGACGGCAAGGATTAC
ATCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGC
CCGTGTGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCGAGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGG
AGACGCTGCAGCGCGCGGACCCCCCAAAGACACACGTGACCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGC
TGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACACTGAGCT
TGTGGAGACCAGACCAGCAGGAGATAGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGAT
ACACATGCCATGTACAGCATGAGGGGCTGCCGAAGCCCCTCACCCTGAGATGGGAGCCGTCTTCCCAGTCCACCGTCCCC
ATCGTGGGCA
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors