Allele Report for B*39:07

B*39:07 View HGVS Report
Pre-2010 Nomenclature: B*3907 Local Names: B*39UW3
IMGT/HLA Acc No: HLA00281 OMIM Entry: *142830
Assigned: 1994-11-04 Sequence Last Modified: 2012-04-12
Source Entries: GQ251374 , JQ683080 , U15640  
Cells Sequence Derived From: 1276 , 60682163 , NT01081  
Known Ethnic Origin Of Source: American Indian, Caucasoid
CWD v2.0 Status: Well-Documented
Publications
Garber TL et al. Immunogenetics 42:19-27 1995. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
HLA Dictionary Data
Expert Assigned Type: B16 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 1 blank [100%]
13 IHWC (2002) - -
Neural Network Assigned Type: B16
Comments:
Protein Sequence (362 aa)
MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEG
PEYWDRNTQICKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAA
DTAAQITQRKWEAARVAEQLRTYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAV
VVIGAVVAAVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA
Nucleotide Sequence Data (1089 bps)
ATGCTGGTCATGGCGCCCCGAACCGTCCTCCTGCTGCTCTCGGCGGCCCTGGCCCTGACCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCTACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGG
CCGGAATATTGGGACCGGAACACACAGATCTGCAAGACCAACACACAGACTTACCGAGAGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTACGGCTGCGACGTGGGGCCGGACGGGCGCCTCC
TCCGCGGGCATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGACCGCGGCG
GACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAACCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGACCCCCCAAAGACACATGTGA
CCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGACCAGCAGGAGACAGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCGAAGCCCC
TCACCCTGAGATGGGAGCCATCTTCCCAGTCCACCGTCCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGTT
GTGGTCATCGGAGCTGTGGTCGCTGCTGTGATGTGTAGGAGGAAGAGTTCAGGTGGAAAAGGAGGGAGCTACTCTCAGGC
TGCGTCCAGCGACAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo