Allele Report for B*39:31

B*39:31 View HGVS Report
Pre-2010 Nomenclature: B*3931 Local Names: NT00509
IMGT/HLA Acc No: HLA01926 OMIM Entry: *142830
Assigned: 2004-05-24 Sequence Last Modified: 2008-04-08
Source Entries: AH013845 , AH014635 , AM746506 , AY607032 , AY607033 , AY829219 , AY829220 , FJ588697 , FJ594607 , FJ594608 , FJ594610 , FJ765828 , FJ765829 , FJ868474 , FJ868480  
Cells Sequence Derived From: HN-01934-3 , HN-12843-3 , HN-15601-2 , HN-21782-2 , HN-37680-0 , HN-37755-0 , HN-37890-9 , HN-81285-3 , LUMC-B3 , NT00509 , VTIS125412  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Lazaro AM et al. Tissue Antigens 68:245-8 2006. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 11 Laboratories: 4
HLA Dictionary Data
Expert Assigned Type: B39 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 2 B39 [100%]
13 IHWC (2002) - -
Neural Network Assigned Type: B39
Comments:
Protein Sequence (298 aa)
MLVMAPRTVLLLLSAALALTETWAGSHSMRYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEG
PEYWDRNTQICKTNTQTDRESLRNLRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAA
DTAAQITQRKWEAARVAEQLRTYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Nucleotide Sequence Data (895 bps)
ATGCTGGTCATGGCGCCCCGAACCGTCCTCCTGCTGCTCTCGGCGGCCCTGGCCCTGACCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCCACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGG
CCGGAATATTGGGACCGGAACACACAGATCTGCAAGACCAACACACAGACTGACCGAGAGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTACGGCTGCGACGTGGGGCCGGACGGGCGCCTCC
TCCGCGGGCATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGACCGCGGCG
GACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAACCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGACCCCCCAAAGACACATGTGA
CCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGACCAGCAGGAGACAGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCGAAGCCCC
TCACCCTGAGATGGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo