Allele Report for B*39:03

B*39:03 View HGVS Report
Pre-2010 Nomenclature: B*3903 Local Names: None
IMGT/HLA Acc No: HLA00276 OMIM Entry: *142830
Assigned: 1992-12-11 Sequence Last Modified: 1998-12-16
Source Entries: AF387907 , AF387908 , AH011013 , L20088  
Cells Sequence Derived From: AUCA#19 , VTIS46155  
Known Ethnic Origin Of Source: American Indian
Publications
Watkins DI et al. Nature 357:329-33 1992. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: B39 WHO Assigned Type: B39(16)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 19 B39 [89%]
13 IHWC (2002) 1 B39
Neural Network Assigned Type: B39
Comments:
Protein Sequence (354 aa)
VLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNT
QICKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTAAQITQ
RKWEAARVAEQLRTYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQ
TQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVA
AVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA
Nucleotide Sequence Data (1065 bps)
GTCCTCCTGCTGCTCTCGGCGGCCCTGGCCCTGACCGAGACCTGGGCCGGCTCCCACTCCATGAGGTATTTCTACACCTC
CGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACGACACGCAGTTCGTGAGGTTCGACA
GCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGGCCGGAATATTGGGACCGGAACACA
CAGATCTGCAAGACCAACACACAGACTGACCGAGAGAGCCTGCGGAACCTGCGCGGCTACTACAACCAGAGCGAGGCCGG
GTCTCACACCCTCCAGAGCATGTACGGCTGCGACGTGGGGCCGGACGGGCGCCTCCTCCGCGGGCATAACCAGTTCGCCT
ACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGACCGCGGCGGACACCGCGGCTCAGATCACCCAG
CGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAACCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATA
CCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGACCCCCCAAAGACACATGTGACCCACCACCCCATCTCTGACCATG
AGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGCGAGGACCAA
ACTCAGGACACCGAGCTTGTGGAGACCAGACCAGCAGGAGACAGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTC
TGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCGAAGCCCCTCACCCTGAGATGGGAGCCATCTT
CCCAGTCCACCGTCCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGTTGTGGTCATCGGAGCTGTGGTCGCT
GCTGTGATGTGTAGGAGGAAGAGTTCAGGTGGAAAAGGAGGGAGCTACTCTCAGGCTGCGTCCAGCGACAGTGCCCAGGG
CTCTGATGTGTCTCTCACAGCTTGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo