Allele Report for B*39:01:05

B*39:01:05 View HGVS Report
Pre-2010 Nomenclature: B*390105 Local Names: BY00306
IMGT/HLA Acc No: HLA03314 OMIM Entry: *142830
Assigned: 2008-04-29 Sequence Last Modified: 2008-10-10
Source Entries: EU643610 , FJ765837  
Cells Sequence Derived From: BY00306 , HN-6381722  
Known Ethnic Origin Of Source: Unknown
Publications
Lazaro AM et al. Tissue Antigens 73:364-72 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: B3901/B39 WHO Assigned Type: B3901
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 7 B39 [96-99%]
NMDP (2008) 476 B39 [95%]
13 IHWC (2002) 21 B39
Neural Network Assigned Type: Training - B16 B39
Comments:
Protein Sequence (181 aa)
SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRNL
RGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRTYLE
GTCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAATATTGGGACCGGAACACACAGATCTGCAAGACCAACACACAGACTGACCGAGAGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTACGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGCATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCGGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAACCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo