Allele Report for B*37:42N

B*37:42N View HGVS Report
Pre-2010 Nomenclature: Local Names: BY01104
IMGT/HLA Acc No: HLA10124 OMIM Entry: *142830
Assigned: 2013-08-31 Sequence Last Modified: 2013-10-11
Source Entries: KF482393 , KF649104  
Cells Sequence Derived From: BY01104 , BY01142  
Known Ethnic Origin Of Source: Caucasoid, Mixed
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (51 aa)
SHSMRYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRTEPGRRGX
Nucleotide Sequence Data (545 bps)
GCTCCCACTCCATGAGGTATTTCCACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGGACGGAGCCCGGGCGCCGTGGATAGAGCAG
GAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGGACCTGCGGACCCT
GCTCCGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCATCCAGAGGATGTCTGGCTGCGACGTGGGGCCGGACGGGC
GCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGACC
GCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGGACAGAGCCTACCTGGA
GGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo