Allele Report for B*37:01:03

B*37:01:03 View HGVS Report
Pre-2010 Nomenclature: B*370103 Local Names: BY00082
IMGT/HLA Acc No: HLA02505 OMIM Entry: *142830
Assigned: 2006-03-26 Sequence Last Modified: 2006-04-07
Source Entries: AH015778 , DQ436824 , DQ436825 , FJ594586 , FJ594621 , FJ619483  
Cells Sequence Derived From: BY00082 , BY00412 , HN-108187 , HN-62256-5  
Known Ethnic Origin Of Source: American Indian, Oriental
Publications
Lazaro AM et al. Tissue Antigens 73:75-6 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 4 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: B37 WHO Assigned Type: B37
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 6 B37 [98-100%]
NMDP (2008) 1721 B37 [93%]
13 IHWC (2002) 27 B37
Neural Network Assigned Type: Training - B37
Comments:
Protein Sequence (181 aa)
SHSMRYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRETQISKTNTQTYREDLRTL
LRYYNQSEAGSHTIQRMSGCDVGPDGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLE
GTCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCCACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGGACGGAGCCCCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACCTACCGAGAGGACCTGCGGACCC
TGCTCCGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCATCCAGAGGATGTCTGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGGACAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo