Allele Report for B*37:01:02

B*37:01:02 View HGVS Report
Pre-2010 Nomenclature: B*370102 Local Names: NT00628
IMGT/HLA Acc No: HLA02418 OMIM Entry: *142830
Assigned: 2006-01-27 Sequence Last Modified: 2006-04-07
Source Entries: AH015513 , DQ334729 , DQ334730 , FJ594557 , HM594789  
Cells Sequence Derived From: HG00000606 , HN-84428-3 , NT00628  
Known Ethnic Origin Of Source: Mixed
Publications
Lazaro AM et al. Tissue Antigens 71:471-4 2008. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: B37 WHO Assigned Type: B37
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 6 B37 [98-100%]
NMDP (2008) 1721 B37 [93%]
13 IHWC (2002) 27 B37
Neural Network Assigned Type: Training - B37
Comments:
Protein Sequence (181 aa)
SHSMRYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRETQISKTNTQTYREDLRTL
LRYYNQSEAGSHTIQRMSGCDVGPDGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLE
GTCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCCACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGGACGGAGCCCCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGGACCTGCGGACCC
TACTCCGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCATCCAGAGGATGTCTGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGGACAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo