Allele Report for B*35:01:25

B*35:01:25 View HGVS Report
Pre-2010 Nomenclature: Local Names: INJE-1001122501
IMGT/HLA Acc No: HLA06583 OMIM Entry: *142830
Assigned: 2011-02-28 Sequence Last Modified: 2011-04-08
Source Entries: JF263564  
Cells Sequence Derived From: INJE-1001122501  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Lee MY et al. Tissue Antigens 78:400-401 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (337 aa)
MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEG
PEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAA
DTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAV
VVIGAVVATVMCRRKSS
Nucleotide Sequence Data (1012 bps)
ATGCGGGTCACGGCGCCCCGAACCGTCCTCCTGCTGCTCTGGGGGGCAGTGGCCCTGACCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACG
ACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGGACGGAGCCCCGGGCGCCATGGATAGAGCAGGAGGGG
CCGGAGTATTGGGACCGGAACACACAGATCTTCAAGACCAACACACAGACTTACCGAGAGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGGTCTCACATCATCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGGCGCCTCC
TCCGCGGGCATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGACCGCGGCG
GACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCCT
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGACCCCCCAAAGACACACGTGA
CCCACCACCCCGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGCGAGGACCAAACTCAGGACACTGAGCTTGTGGAGACCAGACCAGCAGGAGACAGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCGAAGCCCC
TCACCCTGAGATGGGAGCCATCTTCCCAGTCCACCATCCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGTT
GTGGTCATCGGAGCTGTGGTCGCTACTGTGATGTGTAGGAGGAAGAGCTCAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo