Allele Report for B*35:02:02

B*35:02:02 View HGVS Report
Pre-2010 Nomenclature: B*350202 Local Names: B*35SNO1204
IMGT/HLA Acc No: HLA02143 OMIM Entry: *142830
Assigned: 2005-03-22 Sequence Last Modified: 2005-04-08
Source Entries: AJ884579 , FJ588694 , FJ588695 , FJ594727 , FJ868473 , FJ868477 , FJ868484 , FJ868486  
Cells Sequence Derived From: HG00000597 , HN-09297-7 , HN-09514-5 , HN-16306-7 , HN-59372-1 , HN-64433-0 , HN-69984-7 , MHHZ-00013111  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 8 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: B35 WHO Assigned Type: B35
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 3 B35 [94-99%]
NMDP (2008) 1013 B35 [72%]
13 IHWC (2002) 9 B35
Neural Network Assigned Type: Training - B35
Comments:
Protein Sequence (181 aa)
SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNL
RGYYNQSEAGSHIIQRMYGCDLGPDGRFLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLE
GLCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGGACGGAGCCCCGGGCGCCGTGGATAGAGCA
AGAGGGGCCGGAGTATTGGGACCGGAACACACAGATCTTCAAGACCAACACACAGACTTACCGAGAGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACATCATCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGG
CGCTTCCTCCGCGGGCATAACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCCTGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo