Allele Report for B*35:01:07

B*35:01:07 View HGVS Report
Pre-2010 Nomenclature: B*350107 Local Names: CS00004
IMGT/HLA Acc No: HLA03288 OMIM Entry: *142830
Assigned: 2008-03-26 Sequence Last Modified: 2008-04-08
Source Entries: EU564807 , FJ594590  
Cells Sequence Derived From: CS00004 , HN-5812299  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: B35 WHO Assigned Type: B35
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 27 B35 [97-100%]
NMDP (2008) 2023 B35 [98%]
13 IHWC (2002) 58 B35
Neural Network Assigned Type: Training - B35
Comments:
Protein Sequence (181 aa)
SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNL
RGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLE
GLCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGGACGGAGCCCCGGGCGCCATGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGAACACACAGATCTTCAAGACCAACACACAGACTTACCGAGAGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACATCATCCAGAGGATGTATGGCTGCGACCTGGGGCCCGACGGG
CGCCTCCTCCGCGGGCATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCCTGTGCGTGGAGTGGCTTCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo