Allele Report for B*27:05:26

B*27:05:26 View HGVS Report
Pre-2010 Nomenclature: Local Names: FRFGR31371
IMGT/HLA Acc No: HLA10269 OMIM Entry: *142830
Assigned: 2013-09-30 Sequence Last Modified: 2013-10-11
Source Entries: HG427207  
Cells Sequence Derived From: FRFGR31371  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (273 aa)
SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTL
LRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLE
GECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTF
QKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Nucleotide Sequence Data (822 bps)
GCTCCCACTCCATGAGGTATTTCCACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCACCGTGGGCTAC
GTGGACGACACGCTGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTGCAAGGCCAAGGCACAGACTGACCGAGAGGACCTGCGGACCC
TGCTCCGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAATATGTATGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGTACCACCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCGAGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGCAAGGAGACGCTGCAGCGCGCGGACCCCCCAAAGACA
CACGTGACCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCAC
ACTGACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACACTGAGCTTGTGGAGACCAGACCAGCAGGAGATAGAACCT
TCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCG
AAGCCCCTCACCCTGAGATGGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo