Allele Report for B*27:05:10

B*27:05:10 View HGVS Report
Pre-2010 Nomenclature: B*270510 Local Names: 93520
IMGT/HLA Acc No: HLA02826 OMIM Entry: *142830
Assigned: 2007-02-28 Sequence Last Modified: 2007-04-12
Source Entries: EF215529 , FJ600616  
Cells Sequence Derived From: 93520 , HN-2922057  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: B27 WHO Assigned Type: B27
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 6 B27 [99-100%]
NMDP (2008) 1194 B27 [99%]
13 IHWC (2002) 22 B27
Neural Network Assigned Type: Training - B27
Comments:
Protein Sequence (296 aa)
GAVALTETWAGSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAK
AQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTEL
VETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVG
Nucleotide Sequence Data (890 bps)
GGGGGCAGTGGCCCTGACCGAGACCTGGGCTGGCTCCCACTCCATGAGGTATTTCCACACCTCCGTGTCCCGGCCCGGCC
GCGGGGAGCCCCGCTTCATCACCGTGGGCTACGTGGACGACACGCTGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCG
AGAGAGGAGCCGCGGGCACCGTGGATAGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTGCAAGGCCAA
GGCACAGACTGACCGAGAGGACCTGCGGACCCTGCTCCGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGA
ATATGTATGGCTGCGACGTGGGGCCGGACGGGCGCCTCCTCCGCGGGTACCACCAGGACGCCTACGACGGCAAGGATTAC
ATCGCCCTGAACGAGGACCTGAGCTCCTGGACCGCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGC
CCGTGTGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCGAGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGG
AGACGCTGCAGCGCGCGGACCCCCCAAAGACACACGTGACCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGC
TGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACACTGAGCT
TGTGGAGACCAGACCAGCAGGAGATAGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGAT
ACACATGCCATGTACAGCATGAGGGGCTGCCGAAGCCCCTCACCCTGAGATGGGAGCCGTCTTCCCAGTCCACCGTCCCC
ATCGTGGGCA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo