Allele Report for B*27:05:03

B*27:05:03 View HGVS Report
Pre-2010 Nomenclature: B*270503 Local Names: B*27053, B27MW
IMGT/HLA Acc No: HLA00226 OMIM Entry: *142830
Assigned: 1995-02-22 Sequence Last Modified: 2003-07-12
Source Entries: AJ548757 , AJ548758 , X83727 , X83737  
Cells Sequence Derived From: HHE , SF0002  
Known Ethnic Origin Of Source: Caucasoid
Publications
Perasaari JP et al. Tissue Antigens 63:595-7 2004. (View abstract)
Blasczyk R et al. Hum Immunol 45:117-23 1996. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: B27 WHO Assigned Type: B27
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 6 B27 [99-100%]
NMDP (2008) 1194 B27 [99%]
13 IHWC (2002) 22 B27
Neural Network Assigned Type: Training - B27
Comments:
Protein Sequence (181 aa)
SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTL
LRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLE
GECVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCCACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCACCGTGGGCTAC
GTGGACGACACGCTGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTGCAAGGCCAAGGCACAGACTGACCGAGAGGACCTGCGGACCC
TGCTCCGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAATATGTATGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGTACCACCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCCGCGGACACGGCAGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCGAGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo