Allele Report for B*18:49

B*18:49
Pre-2010 Nomenclature: B*1849 Local Names: HIS_NEW_B_463_01446, HIS_NEW_B_593_01594
IMGT/HLA Acc No: HLA04805 OMIM Entry: *142830
Assigned: 2010-02-22 Sequence Last Modified: 2010-04-01
Source Entries: FJ969941 , GQ345039 , GU551810 , HM159320 , HM467494 , JN406453  
Cells Sequence Derived From: HG00001279 , HG00001280 , HG00002246 , HG00003004 , HN-21921-1 , HN-95351-3  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 6 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQISKTNTQTYRENLRNL
RGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLE
GTCVEWLRRHLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCCACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGGCACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGGACGGAGCCCCGGGCGCCGTGGATAGAGCA
AGAGGGGCCGGAGTATTGGGACCGGAACACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGAACCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTACGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGCATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGACACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo