Allele Report for B*15:48

B*15:48 View HGVS Report
Pre-2010 Nomenclature: B*1548 Local Names: B*15New
IMGT/HLA Acc No: HLA00211 OMIM Entry: *142830
Assigned: 1998-10-28 Sequence Last Modified: 2013-04-17
Source Entries: AF072377 , AF072378 , AH006301 , KC702240  
Cells Sequence Derived From: 009326174/HR1858 , MDA0000086  
Known Ethnic Origin Of Source: Caucasoid, Hispanic
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: B62 WHO Assigned Type: B62(15)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 3 B62 [100%]
13 IHWC (2002) - -
Neural Network Assigned Type: B62
Comments:
Protein Sequence (273 aa)
SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNL
RGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRTYLE
GLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTF
QKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Nucleotide Sequence Data (822 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGGATGGCGCCCCGGGCGCCATGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTACGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGCATAACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAACCTACCTGG
AGGGCCTGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGACCCCCCAAAGACA
CATGTGACCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCAC
ACTGACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGACCAGCAGGAGATAGAACCT
TCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCG
AAGCCCCTCACCCTGAGATGGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo