Allele Report for B*15:278

B*15:278 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_B_110465_03942, HIS_NEW_B_110465_03948, HIS_NEW_B_110488_03982, DE HIS_NEW_B_110437_03914, HIS_NEW_B_110457_03934, HIS_NEW_B_110457_03931, DE HIS_NEW_B_110477_03961, HIS_NEW_B_110465_03951, HIS_NEW_B_110471_03954, DE HIS_NEW_B_110465_03940
IMGT/HLA Acc No: HLA09574 OMIM Entry: *142830
Assigned: 2013-05-29 Sequence Last Modified: 2013-07-12
Source Entries: KC473871 , KC592318 , KC592319 , KC603597 , KC603599 , KC603604 , KC603606 , KC632161 , KC748240 , KC859250  
Cells Sequence Derived From: HG00005779 , HG00005780 , HG00005781 , HG00005782 , HG00005783 , HG00005784 , HG00005785 , HG00005786 , HG00005787 , HG00005788  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 10 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEEPEYWDRETQISKTNTQTYRESLRNL
RGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLE
GLCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGGATGGCGCCCCGGGCGCCATGGATAGAGCA
GGAGGAGCCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTACGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGCATGACCAGTCCGCCTACGACGGCAAAGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCGGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGTGGAGAGCCTACCTGG
AGGGCCTGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo