Allele Report for B*15:37

B*15:37 View HGVS Report
Pre-2010 Nomenclature: B*1537 Local Names: None
IMGT/HLA Acc No: HLA00200 OMIM Entry: *142830
Assigned: 1996-06-29 Sequence Last Modified: 1998-12-16
Source Entries: AF016641 , AH003564 , U55022 , U55023  
Cells Sequence Derived From: 11112331 , CTM1984782  
Known Ethnic Origin Of Source: Black, Caucasoid
Publications
Santos S et al. Immunogenetics 47:501-2 1998. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: B70 WHO Assigned Type: B70
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 2 B70 [46%] B71 [11%] B78 [9%]
NMDP (2008) 24 blank [54%] B70 [30%]
13 IHWC (2002) - -
Neural Network Assigned Type: B71
Comments:
Protein Sequence (181 aa)
SHSMRYFYTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTYRESLRNL
RGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLE
GLCVEWLRRHLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGAACACACAGATCTGCAAGACCAACACACAGACTTACCGAGAGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTACGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGCATGACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCGGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCCTGTGCGTGGAGTGGCTCCGCAGACACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo