Allele Report for B*15:30

B*15:30 View HGVS Report
Pre-2010 Nomenclature: B*1530 Local Names: B*1501V1, B*1501Var
IMGT/HLA Acc No: HLA00193 OMIM Entry: *142830
Assigned: 1995-07-20 Sequence Last Modified: 2009-04-17
Source Entries: AH005607 , FJ609980 , HM106514 , JN987184 , KP236588 , L42296 , U49900 , U49901 , U52171 , U52172  
Cells Sequence Derived From: 1-5004 , 1-5026 , BCI-13 , CS00125 , EFTO , GN00104 , GN00108 , UNC3  
Known Ethnic Origin Of Source: American Indian, Caucasoid, Hispanic
CWD v2.0 Status: Common
Publications
Wang J et al. Hum Immunol 55:184-9 1997. (View abstract)
Steiner N et al. Hum Immunol 56:84-93 1997. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 8 Laboratories: 6
HLA Dictionary Data
Expert Assigned Type: B62 WHO Assigned Type: B62(15)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 3 B62 [63-86%] B75 [4-13%] B15 [12-19%]
NMDP (2008) 98 B62 [64%] B15 [17%]
13 IHWC (2002) 3 B62
Neural Network Assigned Type: Training - B15 B62
Comments: ihw13: short B62, short B75 
Protein Sequence (273 aa)
SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNL
RGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLE
GLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTF
QKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Nucleotide Sequence Data (822 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGGATGGCGCCCCGGGCGCCATGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTACGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGCATAACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCGGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGTGGAGAGCCTACCTGG
AGGGCCTGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGACCCCCCAAAGACA
CATGTGACCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCAC
ACTGACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGACCAGCAGGAGATAGAACCT
TCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCG
AAGCCCCTCACCCTGAGATGGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo