Allele Report for B*15:17:02

B*15:17:02 View HGVS Report
Pre-2010 Nomenclature: B*151702 Local Names: B*1517ERN1204
IMGT/HLA Acc No: HLA02141 OMIM Entry: *142830
Assigned: 2005-03-22 Sequence Last Modified: 2005-04-08
Source Entries: AJ880424 , FJ594731 , FJ868478 , FJ868483  
Alignment of CDS Source Entries
B*07:02:01
B*15:17:02
Submission 1
Submission 2

Locus Reference
  Virtual entry for B*15:17:02 
  Individual submission(s) 

This feature is not currently available for some submissions of this allele.
Cells Sequence Derived From: HN-08981-7 , HN-21735-0 , HN-95179-5 , MHHZ-00014019  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.2141 (Allele OID)
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 4 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: B63 WHO Assigned Type: B63(15)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 5 B63 [92-96%]
NMDP (2008) 797 B63 [88%] B15 [3%] B57 [1%]
13 IHWC (2002) 11 B63
Neural Network Assigned Type: Training - B15 B63
Comments:
Protein Sequence (181 aa)
SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETRNMKASAQTYRENLRIA
LRYYNQSEAGSHTLQRMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLE
GLCVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGGATGGCGCCCCGGGCGCCATGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACGGAACATGAAGGCCTCCGCGCAGACTTACCGAGAGAACCTGCGGATCG
CGCTCCGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGGATGTACGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGTACCACCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCGGCGGACACGGCGGCTCAGATCACTCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCCTGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors