Allele Report for B*14:09

B*14:09 View HGVS Report
Pre-2010 Nomenclature: B*1409 Local Names: BY00313
IMGT/HLA Acc No: HLA03318 OMIM Entry: *142830
Assigned: 2008-04-29 Sequence Last Modified: 2008-10-10
Source Entries: EU643603 , FJ235046 , FJ765779  
Cells Sequence Derived From: BY00313 , HN-6998912  
Known Ethnic Origin Of Source: Black
Publications
Lazaro AM et al. Tissue Antigens 73:364-72 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRNL
RGYYNQSEAGSHTLQWMYGCDVGPDGRLLRGYNQFAYDGKDYIALNEDLSSWTAGDTAAQITQRKWEAAREAEQLRAYLE
GTCVEWLRRHLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAATATTGGGACCGGAACACACAGATCTGCAAGACCAACACACAGACTGACCGAGAGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGTGGATGTATGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCGGGGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGACACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo