Allele Report for B*14:07N

B*14:07N View HGVS Report
Pre-2010 Nomenclature: B*1407N Local Names: B*14ne
IMGT/HLA Acc No: HLA02166 OMIM Entry: *142830
Assigned: 2005-04-29 Sequence Last Modified: 2005-07-12
Source Entries: AY973957 , FJ868463  
Cells Sequence Derived From: CTM5683370 , HN-08766-8  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: Not expressed WHO Assigned Type: Null
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) - -
Neural Network Assigned Type: Not tested
Comments:
Protein Sequence (188 aa)
MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEG
PEYWDRNTQICKTNTQTDRESLRNLRGYYNQSEAGSHTLQWMYGCDVGPDGRLLRGYNQFAYDGKDYIALNEDLSSWTAA
DTAAQITQRKWEAAREAEQLRAYLEGTX
Nucleotide Sequence Data (1089 bps)
ATGCTGGTCATGGCGCCCCGAACCGTCCTCCTGCTGCTCTCGGCGGCCCTGGCCCTGACCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCTACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGG
CCGGAATATTGGGACCGGAACACACAGATCTGCAAGACCAACACACAGACTGACCGAGAGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGTGGATGTATGGCTGCGACGTGGGGCCGGACGGGCGCCTCC
TCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGACCGCGGCG
GACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCAC
GTGAGTGGAGTGGCTCCGCAGACACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGACCCCCCAAAGACACATGTGA
CCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGACCAGCAGGAGACAGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCGAAGCCCC
TCACCCTGAGATGGGAGCCATCTTCCCAGTCCACCGTCCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGTT
GTGGTCATCGGAGCTGTGGTCGCTGCTGTGATGTGTAGGAGGAAGAGTTCAGGTGGAAAAGGAGGGAGCTACTCTCAGGC
TGCGTCCAGCGACAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGA
Genomic Sequence Data (3255 bps)
CCGCGTCTGCAATGGGGAGGCGCAGCGTTGGGGATTCCCCACTCCCCTGAGTTTCACTTCTTCTCCCAACTTGTGTCGGG
TCCTTCTTCCAGGATACTCGTGACGCATCCCCACTTCCCACTCCCATTGGGTGTCGGATATCTAGAGAAGCCAATCAGCG
TCGCCGGGGTCCCAGTTCTAAAGTCCCCACGCACCCACCCGGACTCAGAGTCTCCTCAGACGCCAAGATGCTGGTCATGG
CGCCCCGAACCGTCCTCCTGCTGCTCTCGGCGGCCCTGGCCCTGACCGAGACCTGGGCCGGTGAGTGCGGGTCGGGAGGG
AAATGGCCTCTGCCGGGAGGAGCGAGGGGACCGCAGGCGGGGGCGCAGGACCTGAGGAGCCGCGCCGGGAGGAGGGTCGG
GCGGGTTTCAGCCCCTCCTCGCCCCCAGGCTCCCACTCCATGAGGTATTTCTACACCTCCGTGTCCCGGCCCGGCCGCGG
GGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACGACACGCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAG
AGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGGCCGGAATATTGGGACCGGAACACACAGATCTGCAAGACCAACACA
CAGACTGACCGAGAGAGCCTGCGGAACCTGCGCGGCTACTACAACCAGAGCGAGGCCGGTGAGTGACCCCGGCCCGGGGC
GCAGGTCACGACTCCCCATCCCCCACGGACGGCCCGGGTCGCCCCGAGTCTCCGGGTCCGAGATCCGCCTCCCTGAGGCC
GCGGGACCCGCCCAGACCCTCGACCGGCGAGAGCCCCAGGCGCGTTTACCCGGTTTCATTTTCAGTTGAGGCCAAAATCC
CCGCGGGTTGGTCGGGGCGGGGCGGGGCTCGGGGGGACTGGGCTGACCGCGGGGGCGGGGCCAGGGTCTCACACCCTCCA
GTGGATGTATGGCTGCGACGTGGGGCCGGACGGGCGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATT
ACATCGCCCTGAACGAGGACCTGAGCTCCTGGACCGCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCG
GCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCACGTGAGTGGAGTGGCTCCGCAGACACCTGGAGAACGGGAA
GGAGACGCTGCAGCGCGCGGGTACCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTATAGGTCGCCGGGGATGGCCTCCCA
CGAGAAGAAGAGGAAAATGGGATCAGCGCTAGAATGTCGCCCTCCCTTGAATGGAGAATGGCATGAGTTTTCCTGAGTTT
CCTCTGAGGGCCCCCTCTTCTCTCTAGGACAATTAAGGGATGACGTCTCTGAGGAAATGGAGGGGAAGACAGTCCCTAGA
ATACTGATCAGGGGTCCCCTTTGACCCCTGCAGCAGCCTTGGGAACCATGACTTTTCTTCTCAGGCCTTGTTCTCTGCCT
CACACTCAGTGTGTTTGGGGCTCTGATTCCAGCACTTCTGAGTCACTTTACCTCCACTCAGATCAGGAGCAGAAGTCTCT
GTTCCCCGCTCAGAGACTCGAACTTTCCAATGAATAGATTATCCCAGGTGCCTGCGTCCAGGCTGGTGTCTGGGTTCTGT
GTCCCTTCCCCACCCCAGGTGTCCTGTCCATTCTCAGGCTGGTCACATGGGTGGTCCTAGGGTGTCCCATGAGAGATGCA
AAGCGCCTGAATTTTCTGACTCTTCCCATCAGACCCCCCAAAGACACATGTGACCCACCACCCCATCTCTGACCATGAGG
CCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGCGAGGACCAAACT
CAGGACACCGAGCTTGTGGAGACCAGACCAGCAGGAGACAGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGG
AGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCGAAGCCCCTCACCCTGAGATGGGGTAAGGAGGGGG
ATGAGGGGTCATATCTCTTCTCAGGGAAAGCAGGAGCCCTTCAGCAGGGTCAGGGCCCCTCATCTTCCCCTCCTTTCCCA
GAGCCATCTTCCCAGTCCACCGTCCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGTTGTGGTCATCGGAGC
TGTGGTCGCTGCTGTGATGTGTAGGAGGAAGAGTTCAGGTAGGGAAGGGGTGAGGGGTGGGGTCTGGGTTTTCTTGTCCC
ACTGGGGGTTTCAAGCCCCAGGTAGAAGTGTTCCCTGCATCATTACTGGGAAGCAGCATGCACACAGGGGCTAACGCAGC
CTGGGACCCTGTGTGCCAGCACTTACTCTTTTGTGCAGCACATGTGACAATGAAGGACGGATGTATCACCTTGATGGTTG
TGGTGTTGGGGTCCTGATTCCAGCATTCATGAGTCAGGGGAAGGTCCCTGCTAAGGACAGACCTTAGGAGGGCAGTTGGT
CCAGGACCCACACTTGCTTTCCTCGTGTTTCCTGATCCTGCCCTGGGTCTGTAGTCATACTTCTGGAAATTCCTTTTGGG
TCCAAGACTAGGAGGTTCCTCTAAGATCTCATGGCCCTGCTTCCTCCCAGTCCCCTCACAGGACATTTTCTTCCCACAGG
TGGAAAAGGAGGGAGCTACTCTCAGGCTGCGTGTAAGTGGTGGGGGTGGGAGTGTGGAGGAGCTCACCCACCCCATAATT
CCTCCTGTCCCACGTCTCCTGTGGGCTCTGACCAGGTCCTGTTTTTGTTCTACTCCAGCCAGCGACAGTGCCCAGGGCTC
TGATGTGTCTCTCACAGCTTGAAAAGGTGAGATTCTTGGGGTCTAGAGTGGGCGGGGGGGCGGGGAGGGGGCAGAGGGGA
AAGGCCTGGGTAATGGAGATTCTTTGATTGGGATGTTTCGCGTGTGTGATGGGCTGTTCAGAGTGTCATCACTTACCATG
ACTAACCAGAATTTGTTCATGACTGTTGTTTTCTGTAGCCTGAGACAGCTGTCTTGTGAGGGACTGAGATGCAGGATTTC
TTCACGCCTCCCCTTTGTGACTTCAAGAGCCTCTGGCATCTCTTTCTGCAAAGGCACCTGAATGTGTCTGCGTCCCTGTT
AGCATAATGTGAGGAGGTGGAGAGACAGCCCACCCTTGTGTCCACTGTGACCCCT

IMGT/HLA

Sponsors

Animated Sponsors Logo