Allele Report for B*14:02:01

B*14:02:01 View HGVS Report
Pre-2010 Nomenclature: B*140201 Local Names: Bw65
IMGT/HLA Acc No: HLA00158 OMIM Entry: *142830
Assigned: 1989-08-01 Sequence Last Modified: 1998-12-16
Source Entries: AJ301657 , DQ249173 , DQ249176 , M24032 , M59840 , U90558  
Cells Sequence Derived From: 10038822 , BB , CGM1 , CM1402 , PAT135 , PAT218  
Known Ethnic Origin Of Source: Black, Caucasoid, Mixed
Publications
Bronson SK et al. Proc Natl Acad Sci U S A 88:1676-80 1991. (View abstract)
Nair RP et al. Am J Hum Genet 78:827-51 2006. (View abstract)
Parham P et al. Proc Natl Acad Sci U S A 85:4005-9 1988. (View abstract)
Cox ST et al. Tissue Antigens 61:20-48 2003. (View abstract)
Gomez-Casado E et al. Tissue Antigens 53:153-60 1999. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 6 Laboratories: 5
HLA Dictionary Data
Expert Assigned Type: B65 WHO Assigned Type: B65(14)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 9 B65 [50-54%] B14 [45-47%] B64 [1-3%]
NMDP (2008) 2244 B14 [71%] B65 [25%] B64 [2%]
13 IHWC (2002) 22 B65
Neural Network Assigned Type: Training - B14
Comments:
Protein Sequence (362 aa)
MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEG
PEYWDRNTQICKTNTQTDRESLRNLRGYYNQSEAGSHTLQWMYGCDVGPDGRLLRGYNQFAYDGKDYIALNEDLSSWTAA
DTAAQITQRKWEAAREAEQLRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAV
VVIGAVVAAVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA
Nucleotide Sequence Data (1089 bps)
ATGCTGGTCATGGCGCCCCGAACCGTCCTCCTGCTGCTCTCGGCGGCCCTGGCCCTGACCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGG
CCGGAATATTGGGACCGGAACACACAGATCTGCAAGACCAACACACAGACTGACCGAGAGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGTGGATGTATGGCTGCGACGTGGGGCCGGACGGGCGCCTCC
TCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGACCGCGGCG
GACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGACACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGACCCCCCAAAGACACATGTGA
CCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGACCAGACCAGCAGGAGACAGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCGAAGCCCC
TCACCCTGAGATGGGAGCCATCTTCCCAGTCCACCGTCCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGTT
GTGGTCATCGGAGCTGTGGTCGCTGCTGTGATGTGTAGGAGGAAGAGTTCAGGTGGAAAAGGAGGGAGCTACTCTCAGGC
TGCGTCCAGCGACAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGA
Genomic Sequence Data (3312 bps)
GATCAGGACGAAGTCCCAGGTCCCGGACGGGGCTCTCAGGGTCTCAGGCTCCGAGGGCCGCGTCTGCAATGGGGAGGCGC
AGCGTTGGGGATTCCCCACTCCCCTGAGTTTCACTTCTTCTCCCAACTTGTGTCGGGTCCTTCTTCCAGGATACTCGTGA
CGCATCCCCACTTCCCACTCCCATTGGGTGTCGGATATCTAGAGAAGCCAATCAGCGTCGCCGGGGTCCCAGTTCTAAAG
TCCCCACGCACCCACCCGGACTCAGAGTCTCCTCAGACGCCAAGATGCTGGTCATGGCGCCCCGAACCGTCCTCCTGCTG
CTCTCGGCGGCCCTGGCCCTGACCGAGACCTGGGCCGGTGAGTGCGGGTCGGGAGGGAAATGGCCTCTGCCGGGAGGAGC
GAGGGGACCGCAGGCGGGGGCGCAGGACCTGAGGAGCCGCGCCGGGAGGAGGGTCGGGCGGGTTTCAGCCCCTCCTCGCC
CCCAGGCTCCCACTCCATGAGGTATTTCTACACCGCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGG
GCTACGTGGACGACACGCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATA
GAGCAGGAGGGGCCGGAATATTGGGACCGGAACACACAGATCTGCAAGACCAACACACAGACTGACCGAGAGAGCCTGCG
GAACCTGCGCGGCTACTACAACCAGAGCGAGGCCGGTGAGTGACCCCGGCCCGGGGCGCAGGTCACGACTCCCCATCCCC
CACGGACGGCCCGGGTCGCCCCGAGTCTCCGGGTCCGAGATCCGCCTCCCTGAGGCCGCGGGACCCGCCCAGACCCTCGA
CCGGCGAGAGCCCCAGGCGCGTTTACCCGGTTTCATTTTCAGTTGAGGCCAAAATCCCCGCGGGTTGGGCGGGGCGGGGC
GGGGCTCGGGGGGACTGGGCTGACCGCGGGGGCGGGGCCAGGGTCTCACACCCTCCAGTGGATGTATGGCTGCGACGTGG
GGCCGGACGGGCGCCTCCTCCGCGGGTATAACCAGTTCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTG
AGCTCCTGGACCGCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCTGAG
AGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGACACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGGTA
CCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTATAGGTCGCCGGGGATGGCCTCCCACGAGAAGAAGAGGAAAATGGGAT
CAGCGCTAGAATGTCGCCCTCCCTTGAATGGAGAATGGCATGAGTTTTCCTGAGTTTCCTCTGAGGGCCCCCTCTTCTCT
CTAGGACAATTAAGGGATGACGTCTCTGAGGAAATGGAGGGGAAGACAGTCCCTAGAATACTGATCAGGGGTCCCCTTTG
ACCCCTGCAGCAGCCTTGGGAACCATGACTTTTCTTCTCAGGCCTTGTTCTCTGCCTCACACTCAGTGTGTTTGGGGCTC
TGATTCCAGCACTTCTGAGTCACTTTACCTCCACTCAGATCAGGAGCAGAAGTCTCTGTTCCCCGCTCAGAGACTCGAAC
TTTCCAATGAATAGATTATCCCAGGTGCCTGCGTCCAGGCTGGTGTCTGGGTTCTGTGTCCCTTCCCCACCCCAGGTGTC
CTGTCCATTCTCAGGCTGGTCACATGGGTGGTCCTAGGGTGTCCCATGAGAGATGCAAAGCGCCTGAATTTTCTGACTCT
TCCCATCAGACCCCCCAAAGACACATGTGACCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTG
GGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACACCGAGCTTGTGGAGAC
CAGACCAGCAGGAGACAGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCC
ATGTACAGCATGAGGGGCTGCCGAAGCCCCTCACCCTGAGATGGGGTAAGGAGGGGGATGAGGGGTCATATCTCTTCTCA
GGGAAAGCAGGAGCCCTTCAGCAGGGTCAGGGCCCCTCATCTTCCCCTCCTTTCCCAGAGCCATCTTCCCAGTCCACCGT
CCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGTTGTGGTCATCGGAGCTGTGGTCGCTGCTGTGATGTGTA
GGAGGAAGAGTTCAGGTAGGGAAGGGGTGAGGGGTGGGGTCTGGGTTTTCTTGTCCCACTGGGGGTTTCAAGCCCCAGGT
AGAAGTGTTCCCTGCATCATTACTGGGAAGCAGCATGCACACAGGGGCTAACGCAGCCTGGGACCCTGTGTGCCAGCACT
TACTCTTTTGTGCAGCACATGTGACAATGAAGGACGGATGTATCACCTTGATGGTTGTGGTGTTGGGGTCCTGATTCCAG
CATTCATGAGTCAGGGGAAGGTCCCTGCTAAGGACAGACCTTAGGAGGGCAGTTGGTCCAGGACCCACACTTGCTTTCCT
CGTGTTTCCTGATCCTGCCCTGGGTCTGTAGTCATACTTCTGGAAATTCCTTTTGGGTCCAAGACTAGGAGGTTCCTCTA
AGATCTCATGGCCCTGCTTCCTCCCAGTCCCCTCACAGGACATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTACTCTC
AGGCTGCGTGTAAGTGGTGGGGGTGGGAGTGTGGAGGAGCTCACCCACCCCATAATTCCTCCTGTCCCACGTCTCCTGTG
GGCTCTGACCAGGTCCTGTTTTTGTTCTACTCCAGCCAGCGACAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGAA
AAGGTGAGATTCTTGGGGTCTAGAGTGGGCGGGGGGGCGGGGAGGGGGCAGAGGGGAAAGGCCTGGGTAATGGAGATTCT
TTGATTGGGATGTTTCGCGTGTGTGATGGGCTGTTCAGAGTGTCATCACTTACCATGACTAACCAGAATTTGTTCATGAC
TGTTGTTTTCTGTAGCCTGAGACAGCTGTCTTGTGAGGGACTGAGATGCAGGATTTCTTCACGCCTCCCCTTTGTGACTT
CAAGAGCCTCTGGCATCTCTTTCTGCAAAGGCACCTGAATGTGTCTGCGTCCCTGTTAGCATAATGTGAGGAGGTGGAGA
GACAGCCCACCCTTGTGTCCACTGTGACCCCT

IMGT/HLA

Sponsors

Animated Sponsors Logo