Allele Report for B*13:09

B*13:09 View HGVS Report
Pre-2010 Nomenclature: B*1309 Local Names: 2000-112-197
IMGT/HLA Acc No: HLA01486 OMIM Entry: *142830
Assigned: 2001-05-31 Sequence Last Modified: 2001-07-09
Source Entries: AH010803 , AY034808 , AY034809  
Cells Sequence Derived From: 2000-1132-197  
Known Ethnic Origin Of Source: Unknown
Publications
Steiner NK et al. Tissue Antigens 62:263-6 2003. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: Undefined WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) - -
Neural Network Assigned Type: Not assigned
Comments: Bw6pos; NN: B13  
Protein Sequence (181 aa)
SHSMRYFYTAMSRPGRGEPRFITVGYVDDTQFVRFDSDATSPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNL
RGYYNQSEAGSHTWQTMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQLKWEAARVAEQLRAYLE
GECVEWLRRYLENGKETLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCACCGTGGGCTAC
GTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCACGAGTCCGAGGATGGCGCCCCGGGCGCCATGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACTTGGCAGACGATGTATGGCTGCGACCTGGGGCCGGACGGG
CGCCTCCTCCGCGGGCATAACCAGTTAGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGAC
CGCGGCGGACACCGCGGCTCAGATCACCCAGCTCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAGCCTACCTGG
AGGGCGAGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo